APOA1 Antibody - #BF0578

(1)  
Product: APOA1 Antibody
Catalog: BF0578
Description: Mouse monoclonal antibody to APOA1
Application: WB ELISA
Reactivity: Human
Mol.Wt.: 25kDa; 31kD(Calculated).
Uniprot: P02647
RRID: AB_2833629

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFB1605]
Specificity:
APOA1 antibody detects endogenous levels of total APOA1.
RRID:
AB_2833629
Cite Format: Affinity Biosciences Cat# BF0578, RRID:AB_2833629.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apo-AI; ApoA I; ApoA-I; APOA1; APOA1_HUMAN; Apolipoprotein A-I(1-242); Apolipoprotein A1; Apolipoprotein AI; Brp14; Ltw1; Lvtw1; Sep1; Sep2;

Immunogens

Immunogen:

Purified recombinant fragment of human APOA1 expressed in E. Coli.

Uniprot:

P02647(APOA1_HUMAN) >>Visit HPA database.

Gene(ID):
APOA1(335)
Expression:
P02647 APOA1_HUMAN:

Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b genotype and exposure to cigarette smoking. It is also present in increased levels in aortic lesions relative to native ApoA-I and increased levels are seen with increasing severity of disease.

Description:
APOA1: apolipoprotein A-I, it is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. Defects in the Apolipoprotein A I gene are associated with HDL deficiency and Tangier disease. The therapeutic potential of apoA-I has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-I. The availability of recombinant normal apoA-I should facilitate further investigation into the potential usefulness of apoA-I in preventing atherosclerotic vascular diseases.
Sequence:
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

PTMs - P02647 As Substrate

Site PTM Type Enzyme
Y53 Phosphorylation
S55 Phosphorylation
S60 Phosphorylation
K130 Acetylation
K142 Ubiquitination
S166 Phosphorylation
T185 Phosphorylation
Y190 Phosphorylation
S191 Phosphorylation
Y216 Phosphorylation
K219 Acetylation
T221 O-Glycosylation
T221 Phosphorylation
S225 Phosphorylation
T226 Phosphorylation
S228 O-Glycosylation
S252 Phosphorylation
K262 Acetylation

Research Backgrounds

Function:

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.

PTMs:

Glycosylated.

Palmitoylated.

Phosphorylation sites are present in the extracellular medium.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b genotype and exposure to cigarette smoking. It is also present in increased levels in aortic lesions relative to native ApoA-I and increased levels are seen with increasing severity of disease.

Subunit Structure:

Interacts with APOA1BP and CLU. Component of a sperm activating protein complex (SPAP), consisting of APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain and albumin. Interacts with NDRG1. Interacts with SCGB3A2.

Family&Domains:

Belongs to the apolipoprotein A1/A4/E family.

Research Fields

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Digestive system > Fat digestion and absorption.

· Organismal Systems > Digestive system > Vitamin digestion and absorption.

· Organismal Systems > Digestive system > Cholesterol metabolism.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.