| Product: | SDC2 Mouse Monoclonal Antibody |
| Catalog: | BF9493 |
| Description: | Mouse monoclonal antibody to SDC2 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Prediction: | Mouse, Rat, Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 22kDa(Observed); 22kD(Calculated). |
| Uniprot: | P34741 |
Control Products
Product Info
Fold/Unfold
CD362; Fibroglycan; Heparan sulfate proteoglycan core protein; HSPG; SDC2; SDC2_HUMAN; SYND2; Syndecan-2;
Immunogens
A synthesized peptide derived from human SDC2, corresponding to a region within C-terminal amino acids.
- P34741 SDC2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
Research Backgrounds
Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).
O-glycosylated with core 1 or possibly core 8 glycans. Contains heparan sulfate.
Membrane>Single-pass type I membrane protein.
Belongs to the syndecan proteoglycan family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Infectious diseases: Parasitic > Malaria.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.