Product: ALR Mouse Monoclonal Antibody
Catalog: BF9481
Description: Mouse monoclonal antibody to ALR
Application: WB
Reactivity: Human, Mouse
Prediction: Rat, Pig, Zebrafish, Bovine, Horse, Dog, Chicken, Xenopus
Mol.Wt.: 23-25 kDa(Observed); 23kD(Calculated).
Uniprot: P55789

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse IgG
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFfirm9481]
Specificity:
ALR Mouse Monoclonal Antibody detects endogenous levels of total ALR.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Ascitic fluid containing 0.02% proclin300 and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ALR_HUMAN; Augmenter of liver regeneration; ERV1; ERV1 homolog; Erv1 like growth factor; FAD-linked sulfhydryl oxidase ALR; GFER; Growth factor augmenter of liver regeneration; Growth factor erv1 like; Hepatic regenerative stimulation substance; Hepatopoietin; Hepatopoietin protein; hERV1; HPO; HPO1; HPO2; HSS;

Immunogens

Immunogen:

A synthesized peptide derived from human ALR, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P55789 ALR_HUMAN:

Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle.

Sequence:
MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Research Backgrounds

Function:

FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen.

May act as an autocrine hepatotrophic growth factor promoting liver regeneration.

Subcellular Location:

Mitochondrion intermembrane space. Mitochondrion.

Cytoplasm. Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.