Product: CTPS Mouse Monoclonal Antibody
Catalog: BF9466
Description: Mouse monoclonal antibody to CTPS
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 66 kDa; 67kD(Calculated).
Uniprot: P17812

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9466]
Specificity:
CTPS Mouse Monoclonal Antibody detects endogenous levels of total CTPS.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CTP synthase 1; CTP synthase; CTP synthetase 1; CTP synthetase; CTPS; Cytidine 5 prime triphosphate synthetase; Cytidine 5' triphosphate synthetase; IMD24; UTP ammonia ligase 1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P17812 PYRG1_HUMAN:

Widely expressed.

Sequence:
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD

PTMs - P17812 As Substrate

Site PTM Type Enzyme
S12 Phosphorylation
S22 Phosphorylation
Y53 Phosphorylation
R81 Methylation
K84 Ubiquitination
K92 Acetylation
K92 Ubiquitination
Y94 Phosphorylation
Y96 Phosphorylation
K100 Acetylation
K100 Ubiquitination
K103 Ubiquitination
Y106 Phosphorylation
K169 Methylation
K169 Ubiquitination
K171 Acetylation
K195 Ubiquitination
R205 Methylation
S210 Phosphorylation
K227 Ubiquitination
S231 Phosphorylation
Y265 Phosphorylation
K286 Acetylation
K286 Ubiquitination
K306 Acetylation
K306 Ubiquitination
Y307 Phosphorylation
K309 Acetylation
K309 Ubiquitination
K319 Ubiquitination
K331 Ubiquitination
K335 Ubiquitination
T346 Phosphorylation
S347 Phosphorylation
K360 Ubiquitination
C362 S-Nitrosylation
K381 Ubiquitination
R389 Methylation
T428 Phosphorylation
T447 Phosphorylation
T455 Phosphorylation P17612 (PRKACA) , P17252 (PRKCA)
K460 Acetylation
K460 Ubiquitination
S462 Phosphorylation P17252 (PRKCA)
K466 Ubiquitination
Y473 Phosphorylation
R477 Methylation
K489 Methylation
K489 Ubiquitination
K490 Methylation
K490 Ubiquitination
K498 Ubiquitination
K535 Ubiquitination
S552 Phosphorylation
K557 Ubiquitination
S562 Phosphorylation
T566 Phosphorylation
Y567 Phosphorylation
S568 Phosphorylation
R570 Methylation
S571 Phosphorylation P49840 (GSK3A)
S573 Phosphorylation
S574 Phosphorylation
S575 Phosphorylation
S578 Phosphorylation
T581 Phosphorylation
K584 Ubiquitination
S587 Phosphorylation

Research Backgrounds

Function:

This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.

Tissue Specificity:

Widely expressed.

Family&Domains:

Belongs to the CTP synthase family.

Research Fields

· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.