AFfirm™ CTPS Mouse Monoclonal Antibody - #BF9466
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CTP synthase 1; CTP synthase; CTP synthetase 1; CTP synthetase; CTPS; Cytidine 5 prime triphosphate synthetase; Cytidine 5' triphosphate synthetase; IMD24; UTP ammonia ligase 1;
Immunogens
- P17812 PYRG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
PTMs - P17812 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S12 | Phosphorylation | Uniprot | |
S22 | Phosphorylation | Uniprot | |
Y53 | Phosphorylation | Uniprot | |
R81 | Methylation | Uniprot | |
K84 | Ubiquitination | Uniprot | |
K92 | Acetylation | Uniprot | |
K92 | Ubiquitination | Uniprot | |
Y94 | Phosphorylation | Uniprot | |
Y96 | Phosphorylation | Uniprot | |
K100 | Acetylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
K103 | Ubiquitination | Uniprot | |
Y106 | Phosphorylation | Uniprot | |
K169 | Methylation | Uniprot | |
K169 | Ubiquitination | Uniprot | |
K171 | Acetylation | Uniprot | |
K195 | Ubiquitination | Uniprot | |
R205 | Methylation | Uniprot | |
S210 | Phosphorylation | Uniprot | |
K227 | Ubiquitination | Uniprot | |
S231 | Phosphorylation | Uniprot | |
Y265 | Phosphorylation | Uniprot | |
K286 | Acetylation | Uniprot | |
K286 | Ubiquitination | Uniprot | |
K306 | Acetylation | Uniprot | |
K306 | Ubiquitination | Uniprot | |
Y307 | Phosphorylation | Uniprot | |
K309 | Acetylation | Uniprot | |
K309 | Ubiquitination | Uniprot | |
K319 | Ubiquitination | Uniprot | |
K331 | Ubiquitination | Uniprot | |
K335 | Ubiquitination | Uniprot | |
T346 | Phosphorylation | Uniprot | |
S347 | Phosphorylation | Uniprot | |
K360 | Ubiquitination | Uniprot | |
C362 | S-Nitrosylation | Uniprot | |
K381 | Ubiquitination | Uniprot | |
R389 | Methylation | Uniprot | |
T428 | Phosphorylation | Uniprot | |
T447 | Phosphorylation | Uniprot | |
T455 | Phosphorylation | P17612 (PRKACA) , P17252 (PRKCA) | Uniprot |
K460 | Acetylation | Uniprot | |
K460 | Ubiquitination | Uniprot | |
S462 | Phosphorylation | P17252 (PRKCA) | Uniprot |
K466 | Ubiquitination | Uniprot | |
Y473 | Phosphorylation | Uniprot | |
R477 | Methylation | Uniprot | |
K489 | Methylation | Uniprot | |
K489 | Ubiquitination | Uniprot | |
K490 | Methylation | Uniprot | |
K490 | Ubiquitination | Uniprot | |
K498 | Ubiquitination | Uniprot | |
K535 | Ubiquitination | Uniprot | |
S552 | Phosphorylation | Uniprot | |
K557 | Ubiquitination | Uniprot | |
S562 | Phosphorylation | Uniprot | |
T566 | Phosphorylation | Uniprot | |
Y567 | Phosphorylation | Uniprot | |
S568 | Phosphorylation | Uniprot | |
R570 | Methylation | Uniprot | |
S571 | Phosphorylation | P49840 (GSK3A) | Uniprot |
S573 | Phosphorylation | Uniprot | |
S574 | Phosphorylation | Uniprot | |
S575 | Phosphorylation | Uniprot | |
S578 | Phosphorylation | Uniprot | |
T581 | Phosphorylation | Uniprot | |
K584 | Ubiquitination | Uniprot | |
S587 | Phosphorylation | Uniprot |
Research Backgrounds
This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.
Widely expressed.
Belongs to the CTP synthase family.
Research Fields
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.