Product: ATIC Mouse Monoclonal Antibody
Catalog: BF9428
Description: Mouse monoclonal antibody to ATIC
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 64kDa; 65kD(Calculated).
Uniprot: P31939

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9428]
Specificity:
ATIC Mouse Monoclonal Antibody detects endogenous levels of total ATIC.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AICAR formyltransferase/IMP cyclohydrolase; 5 aminoimidazole 4 carboxamide 1 beta D ribonucleotide transformylase/inosinicase; 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase; 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase; 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase; AICAR; AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme; AICAR transformylase; AICARFT; AICARFT/IMPCHASE; ATIC; Bifunctional purine biosynthesis protein PURH; epididymis secretory sperm binding protein Li 70p; FLJ93545; HEL-S-70p; IMP cyclohydrolase; IMP synthase; IMP synthetase; IMPCHASE; Inosinicase; OK/SW-cl.86; Phosphoribosylaminoimidazolecarboxamide formyltransferase; Phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; PUR9_HUMAN; PURH;

Immunogens

Immunogen:

A synthesized peptide derived from human ATIC, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria.
Sequence:
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH

Research Backgrounds

Function:

Bifunctional enzyme that catalyzes 2 steps in purine biosynthesis.

Promotes insulin receptor/INSR autophosphorylation and is involved in INSR internalization.

Family&Domains:

The IMP cyclohydrolase activity resides in the N-terminal region.

Belongs to the PurH family.

Research Fields

· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.

· Metabolism > Nucleotide metabolism > Purine metabolism.

· Metabolism > Metabolism of cofactors and vitamins > One carbon pool by folate.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.