Product: UBE2D1 Mouse Monoclonal Antibody
Catalog: BF9396
Description: Mouse monoclonal antibody to UBE2D1
Application: WB
Reactivity: Human, Mouse
Prediction: Rat, Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus
Mol.Wt.: 17kDa,25kD(UBE2D1-Ub); 17kD(Calculated).
Uniprot: P51668

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFfirm9396]
Specificity:
UBE2D1 Mouse Monoclonal Antibody detects endogenous levels of total UBE2D1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

E2(17)KB1; SFT; Stimulator of Fe transport; UB2D1_HUMAN; UBC 4/5; UBC4/5; UBC4/5 homolog; UBC4/5, S. cerevisiae, homolog of; UBCH 5; UBCH 5A; UbcH5; UBCH5A; Ube2d1; Ubiquitin carrier protein; Ubiquitin carrier protein D1; Ubiquitin conjugating enzyme E2 17 kDa 1; Ubiquitin conjugating enzyme E2 D1; Ubiquitin conjugating enzyme E2D 1 (UBC4/5 homolog yeast); Ubiquitin conjugating enzyme E2D 1; Ubiquitin conjugating enzyme UBCH5A; Ubiquitin protein ligase D1; Ubiquitin-conjugating enzyme E2 D1; Ubiquitin-conjugating enzyme E2(17)KB 1; Ubiquitin-conjugating enzyme E2-17 kDa 1; Ubiquitin-protein ligase D1;

Immunogens

Immunogen:

A synthesized peptide derived from human UBE2D1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P51668 UB2D1_HUMAN:

Ubiquitous. Up-regulated in livers of iron-overloaded patients with hereditary hemochromatosis.

Description:
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene.
Sequence:
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Research Backgrounds

Function:

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4.

PTMs:

Autoubiquitinated in vitro.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous. Up-regulated in livers of iron-overloaded patients with hereditary hemochromatosis.

Family&Domains:

Belongs to the ubiquitin-conjugating enzyme family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.