Product: GLUT3 Mouse Monoclonal Antibody
Catalog: BF8982
Description: Mouse monoclonal antibody to GLUT3
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Horse, Chicken
Mol.Wt.: 54 kDa; 54kD(Calculated).
Uniprot: P11169

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8982]
Specificity:
GLUT3 Mouse Monoclonal Antibody detects endogenous levels of total GLUT3.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

brain; FLJ90380; Glucose transporter type 3; Glucose transporter type 3 brain; GLUT 3; GLUT-3; GLUT3; GTR3_HUMAN; Slc2a3; Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 3; Solute carrier family 2, facilitated glucose transporter member 3;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P11169 GTR3_HUMAN:

Highly expressed in brain. Expressed in many tissues.

Description:
Tissue specificityHighly expressed in brain. Expressed in many tissues.Sequence similaritiesBelongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
Sequence:
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV

PTMs - P11169 As Substrate

Site PTM Type Enzyme
K223 Ubiquitination
T232 Phosphorylation
K243 Ubiquitination
S250 Phosphorylation
K253 Ubiquitination
T333 Phosphorylation
S352 Phosphorylation
K477 Ubiquitination
S485 Phosphorylation
K490 Ubiquitination

Research Backgrounds

Function:

Facilitative glucose transporter that can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Perikaryon. Cell projection.
Note: Localized to densely spaced patches along neuronal processes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in brain. Expressed in many tissues.

Family&Domains:

Transport is mediated via a series of conformation changes, switching between a conformation where the substrate-binding cavity is accessible from the outside, and a another conformation where it is accessible from the cytoplasm.

Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.