Product: TDG Mouse Monoclonal Antibody
Catalog: BF8968
Description: Mouse monoclonal antibody to TDG
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 46 kDa; 46kD(Calculated).
Uniprot: Q13569

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8968]
Specificity:
TDG Mouse Monoclonal Antibody detects endogenous levels of total TDG.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C JUN leucine zipper interactive protein; C JUN leucine zipper interactive protein; C-JUN leucine zipper interactive protein JZA-3; E130317C12Rik; EC 3.2.2.29; G/T mismatch specific thymine DNA glycosylase; G/T mismatch specific thymine DNA glycosylase; G/T mismatch-specific thymine DNA glycosylase; JZA 3; Jza1; T:G mismatch thymine glycosylase; Tdg; TDG_HUMAN; Thymine DNA glycosylase; Thymine-DNA glycosylase;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
In the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. This enzyme corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine
Sequence:
MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

PTMs - Q13569 As Substrate

Site PTM Type Enzyme
K71 Ubiquitination
S82 Phosphorylation
K83 Acetylation
K84 Acetylation
S85 Phosphorylation
K87 Acetylation
K92 Acetylation
K94 Acetylation
K97 Acetylation
K97 Ubiquitination
K103 Ubiquitination
K107 Ubiquitination
Y185 Phosphorylation
K201 Ubiquitination
K206 Ubiquitination
K218 Ubiquitination
K221 Ubiquitination
K232 Ubiquitination
S239 Phosphorylation
K246 Ubiquitination
K248 Sumoylation
K248 Ubiquitination
K258 Ubiquitination
K285 Ubiquitination
K300 Ubiquitination
K330 Sumoylation

Research Backgrounds

Function:

DNA glycosylase that plays a key role in active DNA demethylation: specifically recognizes and binds 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) in the context of CpG sites and mediates their excision through base-excision repair (BER) to install an unmethylated cytosine. Cannot remove 5-hydroxymethylcytosine (5hmC). According to an alternative model, involved in DNA demethylation by mediating DNA glycolase activity toward 5-hydroxymethyluracil (5hmU) produced by deamination of 5hmC. Also involved in DNA repair by acting as a thymine-DNA glycosylase that mediates correction of G/T mispairs to G/C pairs: in the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. Its role in the repair of canonical base damage is however minor compared to its role in DNA demethylation. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine.

PTMs:

Sumoylation on Lys-330 by either SUMO1 or SUMO2 induces dissociation of the product DNA.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer. Interacts with AICDA and GADD45A.

Family&Domains:

Belongs to the uracil-DNA glycosylase (UDG) superfamily. TDG/mug family.

Research Fields

· Genetic Information Processing > Replication and repair > Base excision repair.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.