AFfirm™ Synaptotagmin 1/2 Mouse Monoclonal Antibody - #BF8917
| Product: | Synaptotagmin 1/2 Mouse Monoclonal Antibody |
| Catalog: | BF8917 |
| Description: | Mouse monoclonal antibody to Synaptotagmin 1/2 |
| Application: | WB |
| Reactivity: | Human, Rat |
| Prediction: | Mouse, Pig, Bovine, Horse, Sheep, Rabbit, Dog, Monkey, Chicken, Xenopus |
| Mol.Wt.: | 65kDa; 48kD,47kD(Calculated). |
| Uniprot: | P21579 | Q8N9I0 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
DKFZp781D2042; FLJ42519; p65; SVP65; Synaptotagmin 2; Synaptotagmin I; Synaptotagmin II; Synaptotagmin-1; SYT; Syt1; SYT1_HUMAN; Syt2; SytI; Synaptotagmin 2; Synaptotagmin II; Synaptotagmin-2; Synaptotagmin2; SynaptotagminII; SYT 2; Syt II; Syt2; SYT2_HUMAN; SytII;
Immunogens
A synthesized peptide derived from human Synaptotagmin 1/2, corresponding to a region within the internal amino acids.
Expressed in melanocytes (PubMed:23999003).
Q8N9I0 SYT2_HUMAN:Expressed in melanocytes (PubMed:23999003).
- P21579 SYT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
- Q8N9I0 SYT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
Research Backgrounds
Calcium sensor that participates in triggering neurotransmitter release at the synapse (By similarity). May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse (By similarity). It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2. Plays a role in dendrite formation by melanocytes.
Glycosylated.
Cytoplasmic vesicle>Secretory vesicle membrane>Single-pass membrane protein. Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass membrane protein. Cytoplasmic vesicle>Secretory vesicle>Chromaffin granule membrane>Single-pass membrane protein. Cytoplasm.
Expressed in melanocytes.
The first C2 domain mediates Ca(2+)-dependent phospholipid binding.
The second C2 domain mediates interaction with SV2A and probably with STN2.
Belongs to the synaptotagmin family.
Exhibits calcium-dependent phospholipid and inositol polyphosphate binding properties (By similarity). May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse (By similarity). Plays a role in dendrite formation by melanocytes.
Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass membrane protein. Cytoplasmic vesicle>Secretory vesicle>Chromaffin granule membrane>Single-pass membrane protein.
Expressed in melanocytes.
The first C2 domain mediates Ca(2+)-dependent phospholipid binding.
The second C2 domain mediates interaction with Stonin 2. The second C2 domain mediates phospholipid and inositol polyphosphate binding in a calcium-independent manner.
Belongs to the synaptotagmin family.
Research Fields
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.