AFfirm™ TOM40 Mouse Monoclonal Antibody - #BF8850
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C19orf1; D19S1177E; Haymaker protein; Mitochondrial import receptor subunit TOM40 homolog; Mitochondrial outer membrane protein; Mitochondrial outer membrane protein TOM40; p38.5; PER EC1; PEREC1; Probable mitochondrial import receptor subunit TOM40 homolog; Protein Haymaker; TOM40; TOM40_HUMAN; TOMM40; Translocase of outer membrane 40 kDa subunit homolog; Translocase of outer mitochondrial membrane 40; Translocase of outer mitochondrial membrane 40 homolog (yeast); Translocase of outer mitochondrial membrane 40 homolog; Translocase of outer mitochondrial membrane 40, yeast, homolog of;
Immunogens
- O96008 TOM40_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
PTMs - O96008 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S54 | Phosphorylation | Uniprot | |
| K91 | Ubiquitination | Uniprot | |
| K102 | Ubiquitination | Uniprot | |
| Y129 | Phosphorylation | Uniprot | |
| S142 | Phosphorylation | Uniprot | |
| T144 | Phosphorylation | Uniprot | |
| S157 | Phosphorylation | Uniprot | |
| K175 | Ubiquitination | Uniprot | |
| K184 | Ubiquitination | Uniprot | |
| Y194 | Phosphorylation | Uniprot | |
| Y254 | Phosphorylation | Uniprot | |
| T255 | Phosphorylation | Uniprot | |
| T273 | Phosphorylation | Uniprot | |
| K309 | Ubiquitination | Uniprot | |
| S317 | Phosphorylation | Uniprot | |
| S320 | Phosphorylation | Uniprot | |
| T338 | Phosphorylation | Uniprot |
Research Backgrounds
Channel-forming protein essential for import of protein precursors into mitochondria.
Mitochondrion outer membrane>Multi-pass membrane protein.
Forms part of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex) which consists of at least 7 different proteins (TOMM5, TOMM6, TOMM7, TOMM20, TOMM22, TOMM40 and TOMM70). Interacts with mitochondrial targeting sequences. Interacts with TIMM29; linking the TIM22 complex to the TOM complex. Interacts (via N-terminus) with CYP1A1 (via mitochondrial targeting signal); this interaction is required for CYP1A1 translocation across the mitochondrial outer membrane.
Belongs to the Tom40 family.
Research Fields
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.