Product: TOM40 Mouse Monoclonal Antibody
Catalog: BF8850
Description: Mouse monoclonal antibody to TOM40
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 38 kDa; 38kD(Calculated).
Uniprot: O96008

View similar products>>

   Size Price Inventory
 100ul $140 280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8850]
Specificity:
TOM40 Mouse Monoclonal Antibody detects endogenous levels of total TOM40.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C19orf1; D19S1177E; Haymaker protein; Mitochondrial import receptor subunit TOM40 homolog; Mitochondrial outer membrane protein; Mitochondrial outer membrane protein TOM40; p38.5; PER EC1; PEREC1; Probable mitochondrial import receptor subunit TOM40 homolog; Protein Haymaker; TOM40; TOM40_HUMAN; TOMM40; Translocase of outer membrane 40 kDa subunit homolog; Translocase of outer mitochondrial membrane 40; Translocase of outer mitochondrial membrane 40 homolog (yeast); Translocase of outer mitochondrial membrane 40 homolog; Translocase of outer mitochondrial membrane 40, yeast, homolog of;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

PTMs - O96008 As Substrate

Site PTM Type Enzyme
S54 Phosphorylation
K91 Ubiquitination
K102 Ubiquitination
Y129 Phosphorylation
S142 Phosphorylation
T144 Phosphorylation
S157 Phosphorylation
K175 Ubiquitination
K184 Ubiquitination
Y194 Phosphorylation
Y254 Phosphorylation
T255 Phosphorylation
T273 Phosphorylation
K309 Ubiquitination
S317 Phosphorylation
S320 Phosphorylation
T338 Phosphorylation

Research Backgrounds

Function:

Channel-forming protein essential for import of protein precursors into mitochondria.

Subcellular Location:

Mitochondrion outer membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Forms part of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex) which consists of at least 7 different proteins (TOMM5, TOMM6, TOMM7, TOMM20, TOMM22, TOMM40 and TOMM70). Interacts with mitochondrial targeting sequences. Interacts with TIMM29; linking the TIM22 complex to the TOM complex. Interacts (via N-terminus) with CYP1A1 (via mitochondrial targeting signal); this interaction is required for CYP1A1 translocation across the mitochondrial outer membrane.

Family&Domains:

Belongs to the Tom40 family.

Research Fields

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.