Product: ACAA1 Mouse Monoclonal Antibody
Catalog: BF8846
Description: Mouse monoclonal antibody to ACAA1
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 41 kDa; 44kD(Calculated).
Uniprot: P09110

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8846]
Specificity:
ACAA1 Mouse Monoclonal Antibody detects endogenous levels of total ACAA1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

3 ketoacyl CoA thiolase peroxisomal; 3-ketoacyl-CoA thiolase; ACAA; ACAA1; Acetyl CoA acyltransferase 1; Acetyl Coenzyme A acyltransferase 1; Acetyl-CoA acyltransferase; Acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3 oxoacyl Coenzyme A; Beta ketothiolase; Beta-ketothiolase; Peroxisomal 3 oxoacyl CoA thiolase; Peroxisomal 3 oxoacyl Coenzyme A thiolase; Peroxisomal 3-oxoacyl-CoA thiolase; peroxisomal; PTHIO; THIK_HUMAN; THIO;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

PTMs - P09110 As Substrate

Site PTM Type Enzyme
T59 Phosphorylation
T60 Phosphorylation
T70 Phosphorylation
S124 Phosphorylation
S125 Phosphorylation
S132 Phosphorylation
S141 Phosphorylation
S166 Phosphorylation
K198 Acetylation
K198 Ubiquitination
K209 Ubiquitination
K234 Acetylation
K237 Acetylation
S251 Phosphorylation
T252 Phosphorylation
K259 Acetylation
S269 Phosphorylation
S291 Phosphorylation
K292 Ubiquitination
Y323 Phosphorylation
S337 Phosphorylation
T389 Phosphorylation
K395 Acetylation

Research Backgrounds

Subcellular Location:

Peroxisome.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer.

Family&Domains:

Belongs to the thiolase-like superfamily. Thiolase family.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

· Metabolism > Lipid metabolism > Fatty acid degradation.

· Metabolism > Amino acid metabolism > Valine, leucine and isoleucine degradation.

· Metabolism > Lipid metabolism > alpha-Linolenic acid metabolism.

· Metabolism > Lipid metabolism > Biosynthesis of unsaturated fatty acids.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Fatty acid metabolism.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.