AFfirm™ MOGAT2 Mouse Monoclonal Antibody - #BF8702
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
2 acylglycerol O acyltransferase 2; 2-acylglycerol O-acyltransferase 2; Acyl CoA:monoacylglycerol acyltransferase 2; Acyl-CoA:monoacylglycerol acyltransferase 2; DC5; DGAT2L5; Diacylglycerol acyltransferase 2 like protein 5; Diacylglycerol acyltransferase 2-like protein 5; Diacylglycerol O acyltransferase candidate 5; Diacylglycerol O-acyltransferase candidate 5; EC 2.3.1.22; FLJ22644; hDC5; hMGAT2; Mgat1l; MGAT2; MGC119183; MGC119184; MGC119185; MGC189143; mogat2; MOGT2_HUMAN; Monoacylglycerol O acyltransferase 1 like; Monoacylglycerol O acyltransferase 2; Monoacylglycerol O-acyltransferase 2;
Immunogens
A synthesized peptide derived from human MOGAT2.
- Q3SYC2 MOGT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC
Research Backgrounds
Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Has a preference toward monoacylglycerols containing unsaturated fatty acids in an order of C18:3 > C18:2 > C18:1 > C18:0. Plays a central role in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes. May play a role in diet-induced obesity.
Endoplasmic reticulum membrane>Multi-pass membrane protein. Cytoplasm>Perinuclear region.
Highly expressed in liver, small intestine, colon, stomach and kidney.
Belongs to the diacylglycerol acyltransferase family.
Research Fields
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
· Organismal Systems > Digestive system > Fat digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.