AFfirm™ Apc11 Mouse Monoclonal Antibody - #BF8619
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
ANAPC 11; ANAPC11; Anaphase promoting complex subunit 11 (yeast APC11 homolog); Anaphase promoting complex subunit 11; Anaphase promoting complex subunit 11 homolog (yeast); Anaphase promoting complex subunit 11 homolog; Anaphase-promoting complex subunit 11; Apc 11; Apc 11p; APC11 anaphase promoting complex subunit 11 homolog (yeast); APC11 anaphase promoting complex subunit 11 homolog; APC11; APC11_HUMAN; Apc11p; Cyclosome subunit 11; Hepatocellular carcinoma associated RING finger protein; Hepatocellular carcinoma-associated RING finger protein; HSPC 214; HSPC214; MGC882; Yeast APC 11 homolog; Yeast APC11 homolog;
Immunogens
A synthesized peptide derived from Human Apc11.
Expressed at high levels in skeletal muscle and heart; in moderate levels in brain, kidney, and liver; and at low levels in colon, thymus, spleen, small intestine, placenta, lung and peripheral blood leukocyte.
- Q9NYG5 APC11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Research Backgrounds
Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.
Auto-ubiquitinated.
Cytoplasm. Nucleus.
Expressed at high levels in skeletal muscle and heart; in moderate levels in brain, kidney, and liver; and at low levels in colon, thymus, spleen, small intestine, placenta, lung and peripheral blood leukocyte.
The mammalian APC/C is composed at least of 14 distinct subunits ANAPC1, ANAPC2, CDC27/APC3, ANAPC4, ANAPC5, CDC16/APC6, ANAPC7, CDC23/APC8, ANAPC10, ANAPC11, CDC26/APC12, ANAPC13, ANAPC15 and ANAPC16 that assemble into a complex of at least 19 chains with a combined molecular mass of around 1.2 MDa; APC/C interacts with FZR1 and FBXO5. Interacts with the cullin domain of ANAPC2. Interacts with UBE2D2.
The RING-type zinc finger domain coordinates an additional third zinc ion.
Belongs to the RING-box family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.