AFfirm™ Cytokeratin 2e Mouse Monoclonal Antibody - #BF8605

Product: Cytokeratin 2e Mouse Monoclonal Antibody
Catalog: BF8605
Description: Mouse monoclonal antibody to Cytokeratin 2e
Application: WB
Reactivity: Human
Prediction: Pig, Rabbit, Dog
Mol.Wt.: 65 kDa; 65kD(Calculated).
Uniprot: P35908

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8605]
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CK 2e; Cytokeratin-2e; Epithelial keratin-2e; K2e; Keratin type II cytoskeletal 2 epidermal; Keratin-2 epidermis; KRT2; KRT2A; KRT2E; Type-II keratin Kb2;

Immunogens

Immunogen:

A synthesized peptide derived from human Cytokeratin 2e, corresponding to a region within N-terminal amino acids.

Uniprot:

P35908(K22E_HUMAN) >>Visit HPA database.

Gene(ID):
KRT2(3849)
Expression:
P35908 K22E_HUMAN:

Expressed in the upper spinous and granular suprabasal layers of normal adult epidermal tissues from most body sites including thigh, breast nipple, foot sole, penile shaft and axilla. Not present in foreskin, squamous metaplasias and carcinomas. Expression in hypertrophic and keloid scars begins in the deepest suprabasal layer. Weakly expressed in normal gingiva and tongue, however expression is induced in benign keratoses of lingual mucosa and in mild-to-moderate oral dysplasia with orthokeratinization.

Sequence:
MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQDAIADAEQRGEHALKDARNKLNDLEEALQQAKEDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGDLSSNVTVSVTSSTISSNVASKAAFGGSGGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGGGYGSGGGGSSSVKGSSGEAFGSSVTFSFR

PTMs - P35908 As Substrate

Site PTM Type Enzyme
S62 Phosphorylation
S75 Phosphorylation
K183 Ubiquitination
T184 Phosphorylation
K188 Acetylation
K188 Methylation
K188 Sumoylation
K188 Ubiquitination
S191 Phosphorylation
K195 Acetylation
K195 Ubiquitination
Y264 Phosphorylation
K265 Acetylation
K267 Ubiquitination
S347 Phosphorylation
Y356 Phosphorylation
R490 Methylation
R524 Methylation
S526 Phosphorylation
S527 Phosphorylation
S528 Phosphorylation
S536 Phosphorylation
S546 Phosphorylation
S548 Phosphorylation
S557 Phosphorylation
Y563 Phosphorylation
Y573 Phosphorylation
S579 Phosphorylation
S597 Phosphorylation
S598 Phosphorylation
S602 Phosphorylation
S606 Phosphorylation
S607 Phosphorylation
S608 Phosphorylation
S614 Phosphorylation
S620 Phosphorylation
S621 Phosphorylation
T635 Phosphorylation
S637 Phosphorylation

Research Backgrounds

Function:

Probably contributes to terminal cornification. Associated with keratinocyte activation, proliferation and keratinization. Plays a role in the establishment of the epidermal barrier on plantar skin (By similarity).

Tissue Specificity:

Expressed in the upper spinous and granular suprabasal layers of normal adult epidermal tissues from most body sites including thigh, breast nipple, foot sole, penile shaft and axilla. Not present in foreskin, squamous metaplasias and carcinomas. Expression in hypertrophic and keloid scars begins in the deepest suprabasal layer. Weakly expressed in normal gingiva and tongue, however expression is induced in benign keratoses of lingual mucosa and in mild-to-moderate oral dysplasia with orthokeratinization.

Subunit Structure:

Heterotetramer of two type I and two type II keratins. Associates with KRT10 (By similarity).

Family&Domains:

Belongs to the intermediate filament family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.