AFfirm™ PEX7 Mouse Monoclonal Antibody - #BF8602
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
PBD9B; PCDP1; Peroxin 7; Peroxin-7; Peroxisomal PTS2 receptor; Peroxisomal targeting signal 2 receptor; Peroxisome biogenesis factor 7; Peroxisome targeting signal 2 receptor; PEX7; PEX7 protein; PEX7_HUMAN; PTS2 receptor; PTS2R; RCDP1; RD;
Immunogens
- O00628 PEX7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAKAAGPLQVYKEHAQEVYSVDWSQTRGEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSPTQVADCSWDETIKIYDPACLTIPA
PTMs - O00628 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K138 | Acetylation | Uniprot | |
K186 | Ubiquitination | Uniprot | |
S256 | Phosphorylation | Uniprot | |
S260 | Phosphorylation | Uniprot |
Research Backgrounds
Binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.
Peroxisome. Cytoplasm.
Ubiquitous. Highest expression in pancreas, skeletal muscle and heart.
Interacts with PEX5 (By similarity). Interacts with VWA8.
Belongs to the WD repeat peroxin-7 family.
Research Fields
· Cellular Processes > Transport and catabolism > Peroxisome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.