MMP14 Mouse Monoclonal Antibody | Affinity Biosciences

Product:	MMP14 Mouse Monoclonal Antibody
Catalog:	BF8599
Description:	Mouse monoclonal antibody to MMP14
Application:	WB
Reactivity:	Human
Prediction:	Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.:	55kd, 65kDa; 66kD(Calculated).
Uniprot:	P50281

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Mouse

Application:

WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human

Clonality:

Monoclonal [AFfirm8599]

Conjugate:

Unconjugated.

Purification:

Affinity-chromatography.

Storage:

Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Matrix metallopeptidase 14 (membrane inserted); Matrix metalloproteinase 14; Matrix metalloproteinase-14; Membrane type 1 matrix metalloproteinase; Membrane type 1 metalloprotease; Membrane type matrix metalloproteinase 1; Membrane-type matrix metalloproteinase 1; Membrane-type-1 matrix metalloproteinase; MMP 14; MMP X1; MMP-14; MMP-X1; Mmp14; MMP14_HUMAN; MMPX1; MT MMP 1; MT-MMP 1; MT1 MMP; MT1-MMP; MT1MMP; MTMMP 1; MTMMP1;

Immunogens

Immunogen:

Uniprot:

P50281(MMP14_HUMAN) >>Visit HPA database.

Gene(ID):

MMP14(4323)

Expression:

P50281 MMP14_HUMAN:

Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors.

Description:

MMP14 Seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. Belongs to the peptidase M10A family.

Sequence:

P50281 MMP14_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

PTMs - P50281 As Substrate

P50281

Site	PTM Type	Enzyme	Source
T77	O-Glycosylation		Uniprot
T77	Phosphorylation		Uniprot
Y138	Phosphorylation		Uniprot
T140	Phosphorylation		Uniprot
Y141	Phosphorylation		Uniprot
T291	O-Glycosylation		Uniprot
T299	O-Glycosylation		Uniprot
T300	O-Glycosylation		Uniprot
S301	O-Glycosylation		Uniprot
S304	O-Glycosylation		Uniprot
Y399	Phosphorylation		Uniprot
S462	Phosphorylation		Uniprot
T567	Phosphorylation	P05129 (PRKCG)	Uniprot
Y573	Phosphorylation	P12931 (SRC) , P53667 (LIMK1)	Uniprot
S577	Phosphorylation		Uniprot
K581	Ubiquitination		Uniprot

Research Backgrounds

P50281_MMP14_HUMAN

Function:

Endopeptidase that degrades various components of the extracellular matrix such as collagen. Activates progelatinase A. Essential for pericellular collagenolysis and modeling of skeletal and extraskeletal connective tissues during development (By similarity). May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2. Cleaves ADGRB1 to release vasculostatin-40 which inhibits angiogenesis.

PTMs:

The precursor is cleaved by a furin endopeptidase.

Tyrosine phosphorylated by PKDCC/VLK.

Subcellular Location:

Membrane>Single-pass type I membrane protein. Melanosome. Cytoplasm.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Forms a complex with BST2 and localizes to the cytoplasm.

Tissue Specificity:

Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors.

Subunit Structure:

Interacts (via C-terminal cytoplasmic tail) with BST2. Interacts with DLL1; inhibits DLL1-induced Notch signaling.

Family&Domains:

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Belongs to the peptidase M10A family.

Research Fields

· Environmental Information Processing > Signal transduction > TNF signaling pathway. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

AFfirm™ MMP14 Mouse Monoclonal Antibody - #BF8599