Product: Phospho-Synaptotagmin 1/2 (Ser309) Mouse Monoclonal Antibody
Catalog: BF8567
Description: Mouse monoclonal antibody to Phospho-Synaptotagmin 1/2 (Ser309)
Application: WB
Reactivity: Human
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 47kDa; 48kD,47kD(Calculated).
Uniprot: P21579 | Q8N9I0

View similar products>>

   Size Price Inventory
 100ul $140 280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8567]
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

DKFZp781D2042; FLJ42519; p65; SVP65; Synaptotagmin 2; Synaptotagmin I; Synaptotagmin II; Synaptotagmin-1; SYT; Syt1; SYT1_HUMAN; Syt2; SytI; Synaptotagmin 2; Synaptotagmin II; Synaptotagmin-2; Synaptotagmin2; SynaptotagminII; SYT 2; Syt II; Syt2; SYT2_HUMAN; SytII;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P21579 SYT1_HUMAN:

Expressed in melanocytes (PubMed:23999003).

Q8N9I0 SYT2_HUMAN:

Expressed in melanocytes (PubMed:23999003).

Description:
SYT2 May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone.
Sequence:
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

PTMs - P21579/Q8N9I0 As Substrate

Site PTM Type Enzyme
S24 Phosphorylation
K120 Ubiquitination
T126 Phosphorylation
T129 Phosphorylation
K134 Ubiquitination
Y181 Phosphorylation
T202 Phosphorylation
T212 Phosphorylation
Y217 Phosphorylation
Y230 Phosphorylation
K237 Acetylation
K302 Acetylation
Y312 Phosphorylation
K333 Ubiquitination
Site PTM Type Enzyme
K46 Acetylation
K48 Acetylation
K98 Ubiquitination
T122 Phosphorylation
T125 Phosphorylation
Y178 Phosphorylation
T199 Phosphorylation Q9H4A3 (WNK1)
K299 Acetylation
Y309 Phosphorylation
S378 Phosphorylation
T381 Phosphorylation
T383 Phosphorylation Q9H4A3 (WNK1)

Research Backgrounds

Function:

Calcium sensor that participates in triggering neurotransmitter release at the synapse (By similarity). May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse (By similarity). It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2. Plays a role in dendrite formation by melanocytes.

PTMs:

Glycosylated.

Subcellular Location:

Cytoplasmic vesicle>Secretory vesicle membrane>Single-pass membrane protein. Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass membrane protein. Cytoplasmic vesicle>Secretory vesicle>Chromaffin granule membrane>Single-pass membrane protein. Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in melanocytes.

Subunit Structure:

Homotetramer (Probable). Interacts with SCAMP5. Interacts with STON2. Forms a complex with SV2B, syntaxin 1 and SNAP25 (By similarity). Interacts with SV2A, SV2B and SV2C (By similarity). Interacts with RIMS1 (By similarity). Interacts with PRRT2 (By similarity). Interacts with DNAJC5 in a phosphorylation-dependent manner (By similarity). Interacts (via N-terminus) with RAB3A (By similarity). Interacts with SYT12 (By similarity). Interacts with calmodulin (By similarity).

Family&Domains:

The first C2 domain mediates Ca(2+)-dependent phospholipid binding.

The second C2 domain mediates interaction with SV2A and probably with STN2.

Belongs to the synaptotagmin family.

Function:

Exhibits calcium-dependent phospholipid and inositol polyphosphate binding properties (By similarity). May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse (By similarity). Plays a role in dendrite formation by melanocytes.

Subcellular Location:

Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass membrane protein. Cytoplasmic vesicle>Secretory vesicle>Chromaffin granule membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in melanocytes.

Subunit Structure:

Homotetramer (Probable). Interacts with STON2. Interacts with SCAMP5. Interacts with PRRT2 (By similarity).

Family&Domains:

The first C2 domain mediates Ca(2+)-dependent phospholipid binding.

The second C2 domain mediates interaction with Stonin 2. The second C2 domain mediates phospholipid and inositol polyphosphate binding in a calcium-independent manner.

Belongs to the synaptotagmin family.

Research Fields

· Organismal Systems > Nervous system > Synaptic vesicle cycle.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.