Product: EIF5 Mouse Monoclonal Antibody
Catalog: BF8550
Description: Mouse monoclonal antibody to EIF5
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Dog, Xenopus
Mol.Wt.: 49 kDa; 49kD(Calculated).
Uniprot: P55010

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8550]
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2810011H21Rik; D12Ertd549e; EIF 5; EIF 5A; eIF-5; Eif5; Eukaryotic initiation factor 5; Eukaryotic translation initiation factor 5; IF5_HUMAN; MGC36374; MGC36509;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI

PTMs - P55010 As Substrate

Site PTM Type Enzyme
S2 Phosphorylation
S8 Phosphorylation
S10 Phosphorylation
Y14 Phosphorylation
Y16 Phosphorylation
K24 Acetylation
K24 Ubiquitination
K28 Acetylation
K33 Acetylation
K55 Acetylation
K55 Ubiquitination
K70 Ubiquitination
K95 Ubiquitination
K114 Ubiquitination
K115 Ubiquitination
S121 Phosphorylation
T139 Phosphorylation
S149 Phosphorylation
S151 Phosphorylation
S174 Phosphorylation P67870 (CSNK2B) , P68400 (CSNK2A1)
S175 Phosphorylation
S176 Phosphorylation
T178 Phosphorylation
T207 Phosphorylation P68400 (CSNK2A1)
T208 Phosphorylation P68400 (CSNK2A1)
S220 Phosphorylation
T227 Phosphorylation
S229 Phosphorylation
K261 Ubiquitination
K288 Ubiquitination
Y362 Phosphorylation
K369 Acetylation
S389 Phosphorylation P67870 (CSNK2B) , P68400 (CSNK2A1)
S390 Phosphorylation P68400 (CSNK2A1) , P67870 (CSNK2B)
Y405 Phosphorylation
S406 Phosphorylation
S410 Phosphorylation
T416 Phosphorylation
S419 Phosphorylation

Research Backgrounds

Function:

Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).

Subunit Structure:

Interacts with FMR1 isoform 6; this interaction occurs in a RNA-dependent manner.

Family&Domains:

Belongs to the eIF-2-beta/eIF-5 family.

Research Fields

· Genetic Information Processing > Translation > RNA transport.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.