Product: LSM1 Mouse Monoclonal Antibody
Catalog: BF8546
Description: Mouse monoclonal antibody to LSM1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 15~25 kDa; 15kD(Calculated).
Uniprot: O15116

View similar products>>

   Size Price Inventory
 100ul $140 280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8546]
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cancer associated Sm like protein; Cancer associated Sm-like; Cancer-associated Sm-like; CASM; lsm1; LSM1 antibody; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); Lsm1 protein; LSM1, U6 small nuclear RNA associated; LSM1_HUMAN; Small nuclear ribonuclear CaSm; U6 snRNA associated Sm-like protein LSm1; U6 snRNA-associated Sm-like protein LSm1; YJL124C;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

PTMs - O15116 As Substrate

Site PTM Type Enzyme
S123 Phosphorylation
T129 Phosphorylation
Y133 Phosphorylation

Research Backgrounds

Function:

Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated. Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarity).

Subcellular Location:

Cytoplasm. Cytoplasm>P-body.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with SLBP; interaction with SLBP occurs when histone mRNA is being rapidly degraded during the S phase. LSm subunits form a heteromer with a donut shape (By similarity).

Family&Domains:

Belongs to the snRNP Sm proteins family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.