AFfirm™ PPP1R7 Mouse Monoclonal Antibody - #BF8538
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
MGC105784; PP1R7_HUMAN; PPP1R7; protein phosphatase 1 regulatory (inhibitor) subunit 7; Protein phosphatase 1 regulatory subunit 22; Protein phosphatase 1 regulatory subunit 7 alpha2; Protein phosphatase 1 regulatory subunit 7; Protein phosphatase 1 regulatory subunit 7 beta1; Protein phosphatase 1 regulatory subunit 7 beta2; SDS 22; SDS22;
Immunogens
- Q15435 PP1R7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
PTMs - Q15435 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
S12 | Phosphorylation | Uniprot | |
S24 | Phosphorylation | Uniprot | |
S27 | Phosphorylation | Uniprot | |
K34 | Acetylation | Uniprot | |
S36 | Phosphorylation | Uniprot | |
S37 | Phosphorylation | Uniprot | |
S44 | Phosphorylation | Uniprot | |
S47 | Phosphorylation | Uniprot | |
K49 | Ubiquitination | Uniprot | |
R54 | Methylation | Uniprot | |
R76 | Methylation | Uniprot | |
K90 | Ubiquitination | Uniprot | |
K98 | Ubiquitination | Uniprot | |
K101 | Ubiquitination | Uniprot | |
K111 | Ubiquitination | Uniprot | |
K133 | Ubiquitination | Uniprot | |
K162 | Ubiquitination | Uniprot | |
K167 | Ubiquitination | Uniprot | |
K168 | Ubiquitination | Uniprot | |
K175 | Ubiquitination | Uniprot | |
K178 | Ubiquitination | Uniprot | |
K217 | Ubiquitination | Uniprot | |
K219 | Ubiquitination | Uniprot | |
K222 | Ubiquitination | Uniprot | |
T243 | Phosphorylation | Uniprot | |
K244 | Ubiquitination | Uniprot | |
T277 | Phosphorylation | Uniprot | |
S322 | Phosphorylation | Uniprot | |
Y327 | Phosphorylation | Uniprot | |
K335 | Ubiquitination | Uniprot |
Research Backgrounds
Regulatory subunit of protein phosphatase 1.
Nucleus.
Widely expressed.
Interacts with PPP1CA, PPP1CB and PPP1CC/PPP1G isoform 1.
Belongs to the SDS22 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.