AFfirm™ GOPC Mouse Monoclonal Antibody - #BF8530
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CAL; CFTR associated ligand; CFTR-associated ligand; dJ94G16.2; dJ94G16.2 PIST; FIG; Fused in glioblastoma; Golgi associated PDZ and coiled coil motif containing; Golgi associated PDZ and coiled coil motif containing protein; Golgi-associated PDZ and coiled-coil motif-containing protein; GOPC 1; GOPC; GOPC_HUMAN; GOPC1; OTTHUMP00000040403; PDZ protein interacting specifically with TC 10; PDZ protein interacting specifically with TC10; PDZ/coiled coil domain binding partner for the rho family GTPase TC 10; PDZ/coiled coil domain binding partner for the rho family GTPase TC10; PIST; Protein interacting specifically with Tc 10; Protein interacting specifically with Tc10;
Immunogens
- Q9HD26 GOPC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
PTMs - Q9HD26 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | Uniprot | |
K39 | Ubiquitination | Uniprot | |
S86 | Phosphorylation | Uniprot | |
K93 | Acetylation | Uniprot | |
K93 | Ubiquitination | Uniprot | |
K102 | Sumoylation | Uniprot | |
K102 | Ubiquitination | Uniprot | |
K112 | Ubiquitination | Uniprot | |
K136 | Ubiquitination | Uniprot | |
K147 | Ubiquitination | Uniprot | |
S151 | Phosphorylation | Uniprot | |
K171 | Ubiquitination | Uniprot | |
K180 | Ubiquitination | Uniprot | |
K208 | Ubiquitination | Uniprot | |
K212 | Ubiquitination | Uniprot | |
S276 | Phosphorylation | Uniprot | |
K278 | Ubiquitination | Uniprot | |
K279 | Ubiquitination | Uniprot | |
S280 | Phosphorylation | Uniprot | |
S302 | Phosphorylation | Uniprot | |
K350 | Ubiquitination | Uniprot | |
Y369 | Phosphorylation | Uniprot | |
S376 | Phosphorylation | Uniprot | |
Y383 | Phosphorylation | Uniprot | |
S407 | Phosphorylation | Uniprot | |
K409 | Ubiquitination | Uniprot | |
T411 | Phosphorylation | Uniprot | |
S412 | Phosphorylation | Uniprot | |
K416 | Sumoylation | Uniprot | |
K416 | Ubiquitination | Uniprot | |
K423 | Ubiquitination | Uniprot | |
T441 | Phosphorylation | Uniprot | |
T455 | Phosphorylation | Uniprot | |
Y457 | Phosphorylation | Uniprot | |
K459 | Ubiquitination | Uniprot | |
S461 | Phosphorylation | Uniprot | |
Y462 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in intracellular protein trafficking and degradation. May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels. May also regulate the intracellular trafficking of the ADR1B receptor. May play a role in autophagy. Overexpression results in CFTR intracellular retention and degradation in the lysosomes.
Cytoplasm. Golgi apparatus membrane>Peripheral membrane protein. Golgi apparatus>trans-Golgi network membrane>Peripheral membrane protein. Cell junction>Synapse. Cell junction>Synapse>Postsynaptic density. Cell projection>Dendrite.
Note: Enriched in synaptosomal and postsynaptic densities (PSD) fractions. Expressed in cell bodies and dendrites of Purkinje cells. Localized at the trans-Golgi network (TGN) of spermatids and the medulla of round spermatides.
Ubiquitously expressed.
Homooligomer. Interacts with FZD5, FZD8, GRID2, BECN1, CSPG5 and CLCN3. May interact with CACNG2 (By similarity). Interacts with STX6, CFTR, ASIC3, GOLGA3, NLGN1 and RHOQ.
The PDZ domain mediates interactions with FZD5, FZD8, ASIC3, GRID2, CLCN3 (By similarity). Mediates also interaction with CFTR and ADRB1.
The coiled-coil region probably mediates association to membranes, targeting to the Golgi, and interactions with GOLGA3, and STX6. May also mediate interaction with RHOQ (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.