AFfirm™ GOPC Mouse Monoclonal Antibody - #BF8530

(3)  
Product: GOPC Mouse Monoclonal Antibody
Catalog: BF8530
Description: Mouse monoclonal antibody to GOPC
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Sheep, Dog, Chicken
Mol.Wt.: 51 kDa; 51kD(Calculated).
Uniprot: Q9HD26

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8530]
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CAL; CFTR associated ligand; CFTR-associated ligand; dJ94G16.2; dJ94G16.2 PIST; FIG; Fused in glioblastoma; Golgi associated PDZ and coiled coil motif containing; Golgi associated PDZ and coiled coil motif containing protein; Golgi-associated PDZ and coiled-coil motif-containing protein; GOPC 1; GOPC; GOPC_HUMAN; GOPC1; OTTHUMP00000040403; PDZ protein interacting specifically with TC 10; PDZ protein interacting specifically with TC10; PDZ/coiled coil domain binding partner for the rho family GTPase TC 10; PDZ/coiled coil domain binding partner for the rho family GTPase TC10; PIST; Protein interacting specifically with Tc 10; Protein interacting specifically with Tc10;

Immunogens

Immunogen:
Uniprot:

Q9HD26(GOPC_HUMAN) >>Visit HPA database.

Gene(ID):
GOPC(57120)
Expression:
Q9HD26 GOPC_HUMAN:

Ubiquitously expressed.

Sequence:
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

PTMs - Q9HD26 As Substrate

Site PTM Type Enzyme
S2 Acetylation
S2 Phosphorylation
K39 Ubiquitination
S86 Phosphorylation
K93 Acetylation
K93 Ubiquitination
K102 Sumoylation
K102 Ubiquitination
K112 Ubiquitination
K136 Ubiquitination
K147 Ubiquitination
S151 Phosphorylation
K171 Ubiquitination
K180 Ubiquitination
K208 Ubiquitination
K212 Ubiquitination
S276 Phosphorylation
K278 Ubiquitination
K279 Ubiquitination
S280 Phosphorylation
S302 Phosphorylation
K350 Ubiquitination
Y369 Phosphorylation
S376 Phosphorylation
Y383 Phosphorylation
S407 Phosphorylation
K409 Ubiquitination
T411 Phosphorylation
S412 Phosphorylation
K416 Sumoylation
K416 Ubiquitination
K423 Ubiquitination
T441 Phosphorylation
T455 Phosphorylation
Y457 Phosphorylation
K459 Ubiquitination
S461 Phosphorylation
Y462 Phosphorylation

Research Backgrounds

Function:

Plays a role in intracellular protein trafficking and degradation. May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels. May also regulate the intracellular trafficking of the ADR1B receptor. May play a role in autophagy. Overexpression results in CFTR intracellular retention and degradation in the lysosomes.

Subcellular Location:

Cytoplasm. Golgi apparatus membrane>Peripheral membrane protein. Golgi apparatus>trans-Golgi network membrane>Peripheral membrane protein. Cell junction>Synapse. Cell junction>Synapse>Postsynaptic density. Cell projection>Dendrite.
Note: Enriched in synaptosomal and postsynaptic densities (PSD) fractions. Expressed in cell bodies and dendrites of Purkinje cells. Localized at the trans-Golgi network (TGN) of spermatids and the medulla of round spermatides.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed.

Subunit Structure:

Homooligomer. Interacts with FZD5, FZD8, GRID2, BECN1, CSPG5 and CLCN3. May interact with CACNG2 (By similarity). Interacts with STX6, CFTR, ASIC3, GOLGA3, NLGN1 and RHOQ.

Family&Domains:

The PDZ domain mediates interactions with FZD5, FZD8, ASIC3, GRID2, CLCN3 (By similarity). Mediates also interaction with CFTR and ADRB1.

The coiled-coil region probably mediates association to membranes, targeting to the Golgi, and interactions with GOLGA3, and STX6. May also mediate interaction with RHOQ (By similarity).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.