AFfirm™ CDKN3 Mouse Monoclonal Antibody - #BF8502

Product: CDKN3 Mouse Monoclonal Antibody
Catalog: BF8502
Description: Mouse monoclonal antibody to CDKN3
Application: WB
Reactivity: Human
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 24kDa; 24kD(Calculated).
Uniprot: Q16667

View similar products>>

   Size Price Inventory
 100ul $140 280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8502]
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CDI1; Cdk associated protein phosphatase; CDK2 associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; CDKN3; CDKN3_HUMAN; CIP2; Cyclin dependent kinase inhibitor 3; Cyclin dependent kinase interacting protein 2; Cyclin dependent kinase interactor 1; Cyclin-dependent kinase inhibitor 3; Cyclin-dependent kinase interactor 1; Cyclin-dependent kinase-interacting protein 2; FLJ25787; KAP; KAP1; Kinase associated phosphatase; Kinase-associated phosphatase; MGC70625; OTTHUMP00000178991;

Immunogens

Immunogen:
Uniprot:

Q16667(CDKN3_HUMAN) >>Visit HPA database.

Gene(ID):
CDKN3(1033)
Description:
The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Sequence:
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR

PTMs - Q16667 As Substrate

Site PTM Type Enzyme
S14 Phosphorylation
S15 Phosphorylation
K62 Ubiquitination
K68 Sumoylation
K86 Ubiquitination
K135 Ubiquitination
K184 Ubiquitination
K195 Ubiquitination

Research Backgrounds

Function:

May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.

Subcellular Location:

Cytoplasm>Perinuclear region.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with cyclin-dependent kinases such as CDK1, CDK2 and CDK3. Does not interact with CDK4. Interacts (via C-terminus) with phosphorylated CDK2 (via C-terminal helix). Interacts with MS4A3 (via C-terminus); the interaction enhances CDKN3 enzymatic activity.

Family&Domains:

Belongs to the protein-tyrosine phosphatase family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.