Product: DDX39 Mouse Monoclonal Antibody
Catalog: BF8487
Description: Mouse monoclonal antibody to DDX39
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 50kD; 49kD(Calculated).
Uniprot: O00148

View similar products>>

   Size Price Inventory
 100ul $140 280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8487]
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ATP dependent RNA helicase DDX39; ATP-dependent RNA helicase DDX39A; BAT1; BAT1L; DDX39; DDXL; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 isoform 2; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A; DEAD box protein 39; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 39; Eukaryotic initiation factor 4a; Nuclear RNA helicase URH49; Nuclear RNA helicase, DECD variant of DEAD box family; UAP56 related helicase; UAP56 related helicase, 49 kDa; URH49; wu:fc87b12; zgc:55881;

Immunogens

Immunogen:

A synthesized peptide derived from Human DDX39.

Uniprot:
Gene(ID):
Expression:
O00148 DX39A_HUMAN:

Detected in testis, and at lower levels in brain, kidney, lung, thymus, spleen and salivary gland.

Sequence:
MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDISTYIEQSR

Research Backgrounds

Function:

Involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Can translocate to the cytoplasm in the presence of MX1.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in testis, and at lower levels in brain, kidney, lung, thymus, spleen and salivary gland.

Subunit Structure:

Binds ALYREF/THOC4 and DDX39B/BAT1. Interacts with SARNP. Interacts with human cytomegalovirus/HHV-5 protein UL69. Interacts with MX1. Interacts with MCM3AP isoform GANP.

Family&Domains:

Belongs to the DEAD box helicase family. DECD subfamily.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.