AFfirm™ p23 Mouse Monoclonal Antibody - #BF8454
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Co chaperone p23; cPGES; Cytosolic prostaglandin E synthase; Cytosolic prostaglandin E2 synthase; Hsp90 co chaperone; Hsp90 co-chaperone; P23; Progesterone receptor complex; Progesterone receptor complex p23; Prostaglandin E synthase 3 (cytosolic); Prostaglandin E synthase 3; PTGES 3; PTGES3; Sid 3177; TEBP; TEBP_HUMAN; Telomerase binding protein p23; Telomerase-binding protein p23; Unactive progesterone receptor 23 kD;
Immunogens
A synthesized peptide derived from human p23.
- Q15185 TEBP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
PTMs - Q15185 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K7 | Acetylation | Uniprot | |
| K7 | Ubiquitination | Uniprot | |
| Y14 | Phosphorylation | Uniprot | |
| K33 | Acetylation | Uniprot | |
| K33 | Methylation | Uniprot | |
| K33 | Sumoylation | Uniprot | |
| K33 | Ubiquitination | Uniprot | |
| K35 | Acetylation | Uniprot | |
| K35 | Sumoylation | Uniprot | |
| K35 | Ubiquitination | Uniprot | |
| S39 | Phosphorylation | Uniprot | |
| C40 | S-Nitrosylation | Uniprot | |
| S44 | Phosphorylation | Uniprot | |
| K48 | Acetylation | Uniprot | |
| K48 | Methylation | Uniprot | |
| K48 | Ubiquitination | Uniprot | |
| C58 | S-Nitrosylation | Uniprot | |
| S64 | Phosphorylation | Uniprot | |
| K65 | Sumoylation | Uniprot | |
| K65 | Ubiquitination | Uniprot | |
| K67 | Ubiquitination | Uniprot | |
| S72 | Phosphorylation | Uniprot | |
| C75 | S-Nitrosylation | Uniprot | |
| C76 | S-Nitrosylation | Uniprot | |
| K79 | Sumoylation | Uniprot | |
| K79 | Ubiquitination | Uniprot | |
| S82 | Phosphorylation | Uniprot | |
| S85 | Phosphorylation | Uniprot | |
| K91 | Acetylation | Uniprot | |
| K91 | Ubiquitination | Uniprot | |
| K95 | Sumoylation | Uniprot | |
| K95 | Ubiquitination | Uniprot | |
| S100 | Phosphorylation | Uniprot | |
| S113 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| S118 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| S124 | Phosphorylation | Uniprot | |
| S148 | Phosphorylation | Uniprot | |
| S151 | Phosphorylation | Uniprot |
Research Backgrounds
Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.
Cytoplasm.
Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2. Binds to the progesterone receptor. Interacts with TERT; the interaction, together with HSP90AA1, is required for correct assembly and stabilization of the telomerase holoenzyme complex. Interacts (via PXLE motif) with EGLN1/PHD2, recruiting EGLN1/PHD2 to the HSP90 pathway to facilitate HIF alpha proteins hydroxylation. Interacts with HSP90AA1, FLCN, FNIP1 and FNIP2.
The PXLE motif mediates interaction with EGLN1/PHD2.
Belongs to the p23/wos2 family.
Research Fields
· Metabolism > Lipid metabolism > Arachidonic acid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.