AFfirm™ AIFL Mouse Monoclonal Antibody - #BF8436
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
AIFL; Aifm3; AIFM3_HUMAN; Apoptosis inducing factor 3; Apoptosis inducing factor like; Apoptosis inducing factor like protein; Apoptosis inducing factor, mitochondrion associated; Apoptosis-inducing factor 3; Apoptosis-inducing factor-like protein; FLJ30473; FLJ45137;
Immunogens
Ubiquitous. Expressed in bone marrow, cerebral cortex, liver, ovary, thymus, thyroid gland and tongue (at protein level).
- Q96NN9 AIFM3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWLTGKGS
PTMs - Q96NN9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S36 | Phosphorylation | Uniprot | |
| T45 | Phosphorylation | Uniprot | |
| S415 | Phosphorylation | Uniprot | |
| T433 | Phosphorylation | Uniprot | |
| S439 | Phosphorylation | Uniprot | |
| S445 | Phosphorylation | Uniprot | |
| T470 | Phosphorylation | Uniprot | |
| S605 | Phosphorylation | Uniprot |
Research Backgrounds
Induces apoptosis through a caspase dependent pathway. Reduces mitochondrial membrane potential.
Mitochondrion.
Note: Does not translocate to the nucleus upon induction of apoptosis.
Ubiquitous. Expressed in bone marrow, cerebral cortex, liver, ovary, thymus, thyroid gland and tongue (at protein level).
The Rieske domain induces apoptosis.
Belongs to the FAD-dependent oxidoreductase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.