Product: Phospho-Syntaxin 1A (Ser14) Mouse Monoclonal Antibody
Catalog: BF8343
Description: Mouse monoclonal antibody to Phospho-Syntaxin 1A (Ser14)
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Sheep
Mol.Wt.: 35kDa; 33kD(Calculated).
Uniprot: Q16623

View similar products>>

   Size Price Inventory
 100ul $140 280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8343]
Specificity:
Phospho-Syntaxin 1A (Ser14) Mouse Monoclonal Antibody detects endogenous levels of Syntaxin 1A only when phosphorylated at Serine 14.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

HPC 1; Neuron specific antigen HPC1; Neuron-specific antigen HPC-1; OTTHUMP00000174615; OTTHUMP00000174616; OTTHUMP00000174617; OTTHUMP00000174618; P35-1; STX1; STX1A; STX1A_HUMAN; SYN1A; Syntaxin 1A (brain); Syntaxin 1A brain; Syntaxin-1A;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q16623 STX1A_HUMAN:

Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.

Description:
STX1A is a type IV membrane protein involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. Three splice variant isoforms have been described.
Sequence:
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA

PTMs - Q16623 As Substrate

Site PTM Type Enzyme
S14 Phosphorylation P68400 (CSNK2A1)
T23 Phosphorylation
S64 Phosphorylation
S99 Phosphorylation
C145 S-Nitrosylation
S188 Phosphorylation P53355 (DAPK1)
S249 Phosphorylation
S281 Phosphorylation
T282 Phosphorylation

Research Backgrounds

Function:

Plays an essential role in hormone and neurotransmitter calcium-dependent exocytosis and endocytosis. Part of the SNARE (Soluble NSF Attachment Receptor) complex composed of SNAP25, STX1A and VAMP2 which mediates the fusion of synaptic vesicles with the presynaptic plasma membrane. STX1A and SNAP25 are localized on the plasma membrane while VAMP2 resides in synaptic vesicles. The pairing of the three SNAREs from the N-terminal SNARE motifs to the C-terminal anchors leads to the formation of the SNARE complex, which brings membranes into close proximity and results in final fusion. Participates in the calcium-dependent regulation of acrosomal exocytosis in sperm. Plays also an important role in the exocytosis of hormones such as insulin or glucagon-like peptide 1 (GLP-1) (By similarity).

PTMs:

Phosphorylated by CK2 (By similarity). Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.

Sumoylated, sumoylation is required for regulation of synaptic vesicle endocytosis.

Subcellular Location:

Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome. Cell membrane.
Note: Colocalizes with KCNB1 at the cell membrane.

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.

Subunit Structure:

Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A; this complex constitutes the basic catalytic machinery of the complex neurotransmitter release apparatus. The SNARE complex interacts with CPLX1 (By similarity). Interacts with STXBP1. Interacts (via C-terminus) with KCNB1 (via C-terminus); the interaction increases in a calcium-dependent manner and induces a pore-independent enhancement of exocytosis in neuroendocrine cells, chromaffin cells, pancreatic beta cells and from the soma of dorsal root ganglia (DRG) neurons (By similarity). Interacts with SYTL4 (By similarity). Interacts with STXBP6 (By similarity). Interacts with PLCL1 (via C2 domain) (By similarity). Interacts with OTOF (By similarity). Interacts with LGI3 (By similarity). Interacts with SLC6A4 (By similarity). Interacts with SYT6 and SYT8; the interaction is Ca(2+)-dependent (By similarity). Interacts with VAMP8. Interacts with SNAP23. Interacts with VAPA and SYBU. Interacts with PRRT2 (By similarity). Interacts with SEPT8 (By similarity). Interacts with STXBP5L (By similarity). Interacts with synaptotagmin-1/SYT1 (By similarity).

Family&Domains:

Belongs to the syntaxin family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.

· Human Diseases > Substance dependence > Amphetamine addiction.

· Organismal Systems > Nervous system > Synaptic vesicle cycle.

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.