Product: DKK1 Mouse Monoclonal Antibody
Catalog: BF8416
Description: Mouse monoclonal antibody to DKK1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Xenopus
Mol.Wt.: 28-40kDa; 29kD(Calculated).
Uniprot: O94907

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8416]
Specificity:
DKK1 Mouse Monoclonal Antibody detects endogenous levels of total DKK1
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Dickkopf 1; Dickkopf 1 homolog; Dickkopf 1 like; Dickkopf homolog 1; Dickkopf like protein 1; Dickkopf related protein 1; Dickkopf WNT signaling pathway inhibitor 1; Dickkopf-1; Dickkopf-related protein 1; DKK 1; Dkk-1; Dkk1; DKK1_HUMAN; hDkk 1; hDkk-1; SK;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Sequence:
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

PTMs - O94907 As Substrate

Site PTM Type Enzyme
S61 O-Glycosylation
Y132 Phosphorylation
S140 Phosphorylation
S141 Phosphorylation
T155 O-Glycosylation
S163 O-Glycosylation
T164 O-Glycosylation
S169 O-Glycosylation
T172 O-Glycosylation
T173 O-Glycosylation
T181 O-Glycosylation
T221 Phosphorylation
S255 Phosphorylation
N256 N-Glycosylation
S257 Phosphorylation
S258 Phosphorylation
T262 Phosphorylation

Research Backgrounds

Function:

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity (By similarity).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Placenta.

Subunit Structure:

Interacts with LRP6. Interacts (via the C-termianl Cys-rich domain) with LRP5 (via beta-propeller regions 3 and 4); the interaction, enhanced by MESD and or KREMEN, antagonizes Wnt-mediated signaling. Forms a ternary complex with LRP6 and KREM1. Interacts with KREM1.

Family&Domains:

The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.

Belongs to the dickkopf family.

Research Fields

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.