Product: Caspase 2 Mouse Monoclonal Antibody
Catalog: BF8401
Description: Mouse monoclonal antibody to Caspase 2
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Rabbit
Mol.Wt.: 49kDa; 51kD(Calculated).
Uniprot: P42575

View similar products>>

   Size Price Inventory
 100ul $175 350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8401]
Specificity:
Caspase 2 Mouse Monoclonal Antibody detects endogenous levels of total Caspase 2
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CASP 2; CASP-2; Casp2; CASP2_HUMAN; Caspase 2; Caspase 2 apoptosis related cysteine peptidase; Caspase-2 subunit p12; Caspase2; ICH 1; ICH 1 protease; ICH 1L; ICH1; ICH1 protease; ICH1L; NEDD-2; NEDD2; Neural precursor cell expressed developmentally down-regulated protein 2; PPP1R57; Protease ICH-1; Protein phosphatase 1 regulatory subunit 57;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P42575 CASP2_HUMAN:

Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.

Sequence:
MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT

PTMs - P42575 As Substrate

Site PTM Type Enzyme
A2 Acetylation
S8 Phosphorylation
K15 Ubiquitination
R22 Methylation
K41 Ubiquitination
K77 Sumoylation
K77 Ubiquitination
K93 Ubiquitination
R107 Methylation
S139 Phosphorylation P78527 (PRKDC)
Y151 Phosphorylation
K153 Ubiquitination
S157 Phosphorylation P68400 (CSNK2A1)
T160 Phosphorylation
S164 Phosphorylation
K168 Ubiquitination
K177 Ubiquitination
K214 Ubiquitination
K254 Ubiquitination
K335 Ubiquitination
S340 Phosphorylation
Y368 Phosphorylation
T374 Phosphorylation
K409 Ubiquitination
K415 Ubiquitination
Y420 Phosphorylation
K430 Ubiquitination

Research Backgrounds

Function:

Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. Associates with PIDD1 and CRADD to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis in response to genotoxic stress.

PTMs:

The mature protease can process its own propeptide, but not that of other caspases.

Tissue Specificity:

Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.

Subunit Structure:

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a p18 subunit and a p12 subunit. Forms a complex named the PIDDosome with PIDD1 and CRADD. Interacts with NOL3 (via CARD domain); inhibits CASP2 activity in a phosphorylation-dependent manner.

Family&Domains:

The CARD domain mediates a direct interaction with CRADD.

Belongs to the peptidase C14A family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.