Product: PHGDH Mouse Monoclonal Antibody
Catalog: BF8396
Description: Mouse monoclonal antibody to PHGDH
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 57kDa; 57kD(Calculated).
Uniprot: O43175

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8396]
Specificity:
PHGDH Mouse Monoclonal Antibody detects endogenous levels of total PHGDH
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

3 PGDH; 3-PGDH; 3-phosphoglycerate dehydrogenase; 3PGDH; D-3-phosphoglycerate dehydrogenase; EC 1.1.1.95; Epididymis secretory protein Li 113; HEL S 113; NLS; NLS1; PDG; PGAD; PGD; PGDH; PGDH3; Phgdh; PHGDHD; Phosphoglycerate dehydrogenase; SERA; SERA_HUMAN;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

PTMs - O43175 As Substrate

Site PTM Type Enzyme
R7 Methylation
K8 Ubiquitination
S14 Phosphorylation
K21 Sumoylation
K21 Ubiquitination
K33 Acetylation
K33 Ubiquitination
K38 Ubiquitination
S55 Phosphorylation Q05513 (PRKCZ)
T57 Phosphorylation Q05513 (PRKCZ)
K58 Ubiquitination
T60 Phosphorylation
K69 Ubiquitination
R75 Methylation
T78 Phosphorylation Q05513 (PRKCZ)
T89 Phosphorylation
S105 Phosphorylation
T125 Phosphorylation
S127 Phosphorylation
K129 Ubiquitination
K137 Ubiquitination
T141 Phosphorylation
K146 Ubiquitination
T147 Phosphorylation
R236 Methylation
R247 Methylation
C281 S-Nitrosylation
K289 Acetylation
K289 Ubiquitination
K308 Ubiquitination
S326 Phosphorylation
S349 Phosphorylation
K351 Ubiquitination
T353 Phosphorylation
T358 Phosphorylation
S362 Phosphorylation
K364 Ubiquitination
C369 S-Nitrosylation
S371 Phosphorylation
K380 Ubiquitination
K384 Ubiquitination
K394 Ubiquitination
K398 Ubiquitination
S473 Phosphorylation
T480 Phosphorylation
K522 Ubiquitination

Research Backgrounds

Function:

Catalyzes the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, the first step of the phosphorylated L-serine biosynthesis pathway. Also catalyzes the reversible oxidation of 2-hydroxyglutarate to 2-oxoglutarate and the reversible oxidation of (S)-malate to oxaloacetate.

Subunit Structure:

Homotetramer.

Family&Domains:

Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.

Research Fields

· Metabolism > Amino acid metabolism > Glycine, serine and threonine metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Carbon metabolism.

· Metabolism > Global and overview maps > Biosynthesis of amino acids.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.