Product: Peroxiredoxin 1 Mouse Monoclonal Antibody
Catalog: BF8366
Description: Mouse monoclonal antibody to Peroxiredoxin 1
Application: WB IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 22kDa; 22kD(Calculated).
Uniprot: Q06830

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8366]
Specificity:
Peroxiredoxin 1 Mouse Monoclonal Antibody detects endogenous levels of total Peroxiredoxin 1
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Heme binding 23 kDa protein; MSP23; Natural killer cell-enhancing factor A; NKEF A; NKEF-A; NKEFA; OSF3; Osteoblast specific factor 3; PAG; Paga; PAGB; Peroxiredoxin-1; PRDX1; PRDX1_HUMAN; Proliferation associated gene A; Proliferation-associated gene protein; PRX1; PrxI; TDPX2; Thioredoxin peroxidase 2; Thioredoxin-dependent peroxide reductase 2;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

PTMs - Q06830 As Substrate

Site PTM Type Enzyme
S2 Acetylation
K7 Acetylation
K7 Sumoylation
K7 Ubiquitination
K16 Acetylation
K16 Methylation
K16 Sumoylation
K16 Ubiquitination
T18 Phosphorylation Q13043 (STK4)
K27 Acetylation
K27 Methylation
K27 Ubiquitination
S30 Phosphorylation
S32 Phosphorylation Q96KB5 (PBK)
Y34 Phosphorylation
K35 Acetylation
K35 Ubiquitination
K37 Acetylation
K37 Ubiquitination
C52 S-Nitrosylation
K67 Acetylation
K67 Sumoylation
K68 Ubiquitination
S77 Phosphorylation
S80 Phosphorylation
T90 Phosphorylation P24941 (CDK2) , Q00534 (CDK6) , P06493 (CDK1) , P11802 (CDK4) , Q13043 (STK4)
K92 Acetylation
K93 Acetylation
K93 Sumoylation
K93 Ubiquitination
S106 Phosphorylation
K109 Acetylation
K109 Ubiquitination
T111 Phosphorylation
Y116 Phosphorylation
K120 Ubiquitination
S126 Phosphorylation
K136 Acetylation
K136 Ubiquitination
T143 Phosphorylation
R151 Methylation
S152 Phosphorylation
T156 Phosphorylation
R158 Methylation
T166 Phosphorylation
K168 Acetylation
K168 Ubiquitination
C173 S-Nitrosylation
K178 Acetylation
K178 Methylation
K178 Ubiquitination
S181 Phosphorylation
T183 Phosphorylation Q13043 (STK4)
K185 Acetylation
K185 Sumoylation
K185 Ubiquitination
K190 Ubiquitination
K192 Sumoylation
K192 Ubiquitination
Y194 Phosphorylation P06239 (LCK)
S196 Phosphorylation
K197 Acetylation
K197 Ubiquitination

Research Backgrounds

Function:

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).

PTMs:

Phosphorylated on Thr-90 during the M-phase, which leads to a more than 80% decrease in enzymatic activity.

The enzyme can be inactivated by further oxidation of the cysteine sulfenic acid (C(P)-SOH) to sulphinic acid (C(P)-SO2H) instead of its condensation to a disulfide bond. It can be reactivated by forming a transient disulfide bond with sulfiredoxin SRXN1, which reduces the cysteine sulfinic acid in an ATP- and Mg-dependent manner.

Subcellular Location:

Cytoplasm. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer; disulfide-linked, upon oxidation. 5 homodimers assemble to form a ring-like decamer. Interacts with GDPD5; forms a mixed-disulfide with GDPD5 (By similarity). Interacts with SESN1 and SESN2. Interacts with FAM107A.

Family&Domains:

Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.