EIF6 Mouse Monoclonal Antibody | Affinity Biosciences

1/9

Western blot analysis of extracts from COLO205 cells(heat-shock treatment), using EIF6 Mouse Monoclonal Antibody at 1/1000 dilution.

Western blot analysis of extracts from 293 cells(serum starvation treatment), using EIF6 Mouse Monoclonal Antibody at 1/1000 dilution.

Western blot analysis of extracts from HUVEC cells(heat-shock treatment), using EIF6 Mouse Monoclonal Antibody at 1/1000 dilution.

Western blot analysis of extracts from EC304 cells(heat-shock treatment), using EIF6 Mouse Monoclonal Antibody at 1/1000 dilution.

Western blot analysis of extracts from HepG2 cells(LPS 4h treatment), using EIF6 Mouse Monoclonal Antibody at 1/1000 dilution.

Western blot analysis of extracts from Rat kidney, using EIF6 Mouse Monoclonal Antibody at 1/1000 dilution.

Western blot analysis of extracts from Rat spleen, using EIF6 Mouse Monoclonal Antibody at 1/1000 dilution.

Western blot analysis of extracts from Mouse testis, using EIF6 Mouse Monoclonal Antibody at 1/1000 dilution.

BF8325 at 1/100 staining rat testis tissue by IHC-P.

Product:	EIF6 Mouse Monoclonal Antibody
Catalog:	BF8325
Description:	Mouse monoclonal antibody to EIF6
Application:	WB IHC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.:	27kDa; 27kD(Calculated).
Uniprot:	P56537

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Mouse

Application:

WB 1:500-1:3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Monoclonal [AFfirm8325]

Specificity:

EIF6 Mouse Monoclonal Antibody detects endogenous levels of total EIF6

Conjugate:

Unconjugated.

Purification:

Affinity-chromatography.

Storage:

Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

b(2)gcn; B(2)GCN homolog; B4 integrin interactor; Binding protein of beta-4 integrin; CAB; eIF-6; EIF3A; EIF6; Eukaryotic translation initiation factor 3A; Eukaryotic translation initiation factor 6; IF6_HUMAN; ITGB4BP; OK/SW-cl.27; p27 beta 4 integrin binding protein; p27(BBP); p27BBP; RP4-614O4.1;

Immunogens

Immunogen:

Uniprot:

P56537(IF6_HUMAN) >>Visit HPA database.

Gene(ID):

EIF6(3692)

Expression:

P56537 IF6_HUMAN:

Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level).

Description:

Eukaryotic initiation factor 6 (eIF6) is reqiured for the 60S ribosomal subunit assembly in the nucleolus (1). In the cytoplasm, this protein is bound to 60S ribosome subunits and prevents them from joining 40S ribosome subunits to form 80S ribosomes (2). eIF6 is also shown to associate with the RNA-induced silencing complex (RISC) (3). Deletion of eIF6 abolishes the miRNA-mediated gene silencing (3). eIF6 may play its essential role in miRNA-mediated silencing by inhibiting translation initiation or ribosome recycling (3).

Sequence:

P56537 IF6_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

PTMs - P56537 As Substrate

P56537

Site	PTM Type	Enzyme	Source
S6	Phosphorylation		Uniprot
C11	S-Nitrosylation		Uniprot
C15	S-Nitrosylation		Uniprot
R85	Methylation		Uniprot
R95	Methylation		Uniprot
Y113	Phosphorylation		Uniprot
S150	Phosphorylation		Uniprot
S174	Phosphorylation	P48729 (CSNK1A1)	Uniprot
S175	Phosphorylation	P48729 (CSNK1A1)	Uniprot
T185	Phosphorylation		Uniprot
K223	Acetylation		Uniprot
S230	Phosphorylation		Uniprot
T231	Phosphorylation		Uniprot
T234	Phosphorylation		Uniprot
S235	Phosphorylation	P17252 (PRKCA) , P05771 (PRKCB)	Uniprot
S239	Phosphorylation		Uniprot
S243	Phosphorylation		Uniprot
T245	Phosphorylation		Uniprot

Research Backgrounds

P56537_IF6_HUMAN

Function:

Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. Behaves as a stimulatory translation initiation factor downstream insulin/growth factors. Is also involved in ribosome biogenesis. Associates with pre-60S subunits in the nucleus and is involved in its nuclear export. Cytoplasmic release of TIF6 from 60S subunits and nuclear relocalization is promoted by a RACK1 (RACK1)-dependent protein kinase C activity. In tissues responsive to insulin, controls fatty acid synthesis and glycolysis by exerting translational control of adipogenic transcription factors such as CEBPB, CEBPD and ATF4 that have G/C rich or uORF in their 5'UTR. Required for ROS-dependent megakaryocyte maturation and platelets formation, controls the expression of mitochondrial respiratory chain genes involved in reactive oxygen species (ROS) synthesis (By similarity). Involved in miRNA-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. Modulates cell cycle progression and global translation of pre-B cells, its activation seems to be rate-limiting in tumorigenesis and tumor growth (By similarity).

PTMs:

Phosphorylation at Ser-174 and Ser-175 by CSNK1D/CK1 promotes nuclear export.

Subcellular Location:

Cytoplasm. Nucleus>Nucleolus.
Note: Shuttles between cytoplasm and nucleus/nucleolus.

Tissue Specificity:

Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level).

Subunit Structure:

Monomer. Associates with the 60S ribosomal subunit. Interacts with RACK1. Interacts with DICER1, AGO2, TARBP2, MOV10 and RPL7A; they form a large RNA-induced silencing complex (RISC).

Family&Domains:

Belongs to the eIF-6 family.

Research Fields

· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

AFfirm™ EIF6 Mouse Monoclonal Antibody - #BF8325