AFfirm™ Cathepsin D Mouse Monoclonal Antibody - #BF8281

(9)  
Product: Cathepsin D Mouse Monoclonal Antibody
Catalog: BF8281
Description: Mouse monoclonal antibody to Cathepsin D
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Dog
Mol.Wt.: 44 kDa, 25 kDa; 45kD(Calculated).
Uniprot: P07339

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8281]
Specificity:
Cathepsin D Mouse Monoclonal Antibody detects endogenous levels of total Cathepsin D
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CatD; CATD_HUMAN; Cathepsin D; Cathepsin D heavy chain; CD; Ceroid lipofuscinosis neuronal 10; CLN10; CPSD; ctsd; Epididymis secretory sperm binding protein Li 130P; HEL S 130P; Lysosomal aspartyl peptidase; Lysosomal aspartyl protease; MGC2311;

Immunogens

Immunogen:
Uniprot:

P07339(CATD_HUMAN) >>Visit HPA database.

Gene(ID):
CTSD(1509)
Expression:
P07339 CATD_HUMAN:

Expressed in the aorta extracellular space (at protein level) (PubMed:20551380). Expressed in liver (at protein level) (PubMed:1426530).

Description:
Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Sequence:
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

PTMs - P07339 As Substrate

Site PTM Type Enzyme
K28 Ubiquitination
S37 Phosphorylation
S42 Phosphorylation
K49 Ubiquitination
K54 Ubiquitination
T63 O-Glycosylation
K127 Ubiquitination
N134 N-Glycosylation
K184 Ubiquitination
T250 Phosphorylation
S252 Phosphorylation
K253 Ubiquitination
N263 N-Glycosylation
K313 Ubiquitination
Y325 Phosphorylation
K331 Ubiquitination
S333 Phosphorylation
T334 Phosphorylation
T339 Phosphorylation
K341 Ubiquitination
Y347 Phosphorylation
K348 Ubiquitination
Y354 Phosphorylation
K357 Ubiquitination
Y394 Phosphorylation

Research Backgrounds

Function:

Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

PTMs:

N- and O-glycosylated.

Undergoes proteolytic cleavage and activation by ADAM30.

As well as the major heavy chain which starts at Leu-169, 2 minor forms starting at Gly-170 and Gly-171 have been identified. An additional form starting at Ala-168 has also been identified.

Subcellular Location:

Lysosome. Melanosome. Secreted>Extracellular space.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV. In aortic samples, detected as an extracellular protein loosely bound to the matrix (PubMed:20551380).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the aorta extracellular space (at protein level). Expressed in liver (at protein level).

Subunit Structure:

Consists of a light chain and a heavy chain. Interacts with ADAM30; this leads to activation of CTSD. Interacts with GRN; stabilizes CTSD; increases its proteolytic activity (By similarity).

Family&Domains:

Belongs to the peptidase A1 family.

Research Fields

· Cellular Processes > Transport and catabolism > Autophagy - animal.   (View pathway)

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.