Product: GPR120 Mouse Monoclonal Antibody
Catalog: BF8192
Description: Mouse monoclonal antibody to GPR120
Application: WB IHC
Reactivity: Human, Mouse
Prediction: Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 42 kDa; 42kD(Calculated).
Uniprot: Q5NUL3

View similar products>>

   Size Price Inventory
 100ul $140 280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFfirm8192]
Specificity:
GPR120 Antibody detects endogenous levels of total GPR120.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

G protein coupled receptor 120; G protein coupled receptor 129; G protein coupled receptor GT01; G protein coupled receptor PGR 4; G protein coupled receptor PGR4; G-protein coupled receptor 120; G-protein coupled receptor 129; G-protein coupled receptor GT01; G-protein coupled receptor PGR4; GPR 120; GPR 129; GPR120; GPR129; GT01; HGNC:19345; MGC119984; O3FA1_HUMAN; O3FAR1; Omega-3 fatty acid receptor 1; PGR 4; PGR4;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q5NUL3 FFAR4_HUMAN:

Abundant expression in the intestinal tract. Highly expressed in adipose tissue, small intestine and pancreas.

Description:
GPR120, a member of the rhodopsin family of G protein-coupled receptors (GPCRs), is a 377 amino acid protein which is expressed in the intestine. GPR120 is a receptor for unsaturated long-chain FFAs (free fatty acids). FFAs act as signaling molecules and are an important energy source
Sequence:
MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG

PTMs - Q5NUL3 As Substrate

Site PTM Type Enzyme
S253 Phosphorylation
T258 Phosphorylation
Y263 Phosphorylation
S266 Phosphorylation
T363 Phosphorylation
S366 Phosphorylation

Research Backgrounds

Function:

Receptor for medium and long-chain free fatty acids (FFAs). Signals via a G(q)/G(11)-coupled pathway. Acts as a receptor for omega-3 fatty acids and mediates robust anti-inflammatory effects, particularly in macrophages and fat cells. The anti-inflammatory effects involve inhibition of TAK1 through a beta-arrestin 2 (ARRB2)/TAB1-dependent effect, but independent of the G(q)/G(11)-coupled pathway. Mediates potent insulin sensitizing and antidiabetic effects by repressing macrophage-induced tissue inflammation. May mediate the taste of fatty acids. Mediates FFA-induced inhibition of apoptosis in enteroendocrine cells. May play a role in the regulation of adipocyte development and differentiation.

PTMs:

Phosphorylated. FFA stimulation facilitates phosphorylation.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.
Note: Colocalized with ARRB2 following DHA treatment.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Abundant expression in the intestinal tract. Highly expressed in adipose tissue, small intestine and pancreas.

Subunit Structure:

Interacts with ARRB2 following docosahexaenoic acid (DHA) stimulation.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.