AFfirm™ BCL7B Mouse Monoclonal Antibody - #BF8098
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
B cell CLL/lymphoma 7 protein family member B; B cell CLL/lymphoma 7B; B-cell CLL/lymphoma 7 protein family member B; BCL 7B; BCL7B; BCL7B_HUMAN;
Immunogens
- Q9BQE9 BCL7B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
PTMs - Q9BQE9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K27 | Ubiquitination | Uniprot | |
| K34 | Ubiquitination | Uniprot | |
| T41 | Phosphorylation | Uniprot | |
| S107 | Phosphorylation | Uniprot | |
| S108 | Phosphorylation | Uniprot | |
| T109 | Phosphorylation | Uniprot | |
| S112 | Phosphorylation | Uniprot | |
| S114 | Phosphorylation | Uniprot | |
| S118 | Phosphorylation | Uniprot | |
| S120 | Phosphorylation | Uniprot | |
| S122 | Phosphorylation | Uniprot | |
| T126 | Phosphorylation | Uniprot | |
| S127 | Phosphorylation | Uniprot | |
| T131 | Phosphorylation | Uniprot | |
| S134 | Phosphorylation | Uniprot | |
| S180 | Phosphorylation | Uniprot | |
| K186 | Ubiquitination | Uniprot | |
| C189 | S-Nitrosylation | Uniprot | |
| T194 | Phosphorylation | Uniprot | |
| S200 | Phosphorylation | Uniprot |
Research Backgrounds
Positive regulator of apoptosis. Plays a role in the Wnt signaling pathway, negatively regulating the expression of Wnt signaling components CTNNB1 and HMGA1. Involved in cell cycle progression, maintenance of the nuclear structure and stem cell differentiation. May play a role in lung tumor development or progression (By similarity).
Ubiquitous.
Belongs to the BCL7 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.