AFfirm™ Glutamine Synthetase Mouse Monoclonal Antibody - #BF8094

(1)  
Product: Glutamine Synthetase Mouse Monoclonal Antibody
Catalog: BF8094
Description: Mouse monoclonal antibody to Glutamine Synthetase
Application: IHC
Reactivity: Human
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 42 kDa; 42kD(Calculated).
Uniprot: P15104

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8094]
Specificity:
Glutamine Synthetase Antibody detects endogenous levels of total Glutamine Synthetase.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

cell proliferation-inducing protein 59; GLNA; GLNA_HUMAN; GLNS; GLUL; Glutamate ammonia ligase; Glutamate decarboxylase; Glutamate--ammonia ligase; glutamine synthase; Glutamine synthetase; GS; PIG 43; PIG 59; PIG43; PIG59; Proliferation inducing protein 43;

Immunogens

Immunogen:
Uniprot:

P15104(GLNA_HUMAN) >>Visit HPA database.

Gene(ID):
GLUL(2752)
Expression:
P15104 GLNA_HUMAN:

Expressed in endothelial cells.

Sequence:
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

PTMs - P15104 As Substrate

Site PTM Type Enzyme
T2 Acetylation
K11 Acetylation
K11 Ubiquitination
K14 Acetylation
K14 Ubiquitination
Y17 Phosphorylation
S19 Phosphorylation
K25 Ubiquitination
K52 Ubiquitination
K91 Ubiquitination
K95 Ubiquitination
K103 Acetylation
K103 Ubiquitination
Y104 Phosphorylation
Y180 Phosphorylation
C183 S-Nitrosylation
Y185 Phosphorylation
K259 Ubiquitination
K268 Ubiquitination
Y269 Phosphorylation
K276 Ubiquitination
K291 Ubiquitination
T301 Phosphorylation
S320 Phosphorylation
S322 Phosphorylation
K334 Ubiquitination
Y336 Phosphorylation
S343 Phosphorylation
C359 S-Nitrosylation
Y371 Phosphorylation
K372 Acetylation
K372 Ubiquitination

Research Backgrounds

Function:

Glutamine synthetase that catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine. Its role depends on tissue localization: in the brain, it regulates the levels of toxic ammonia and converts neurotoxic glutamate to harmless glutamine, whereas in the liver, it is one of the enzymes responsible for the removal of ammonia (By similarity). Essential for proliferation of fetal skin fibroblasts. Independently of its glutamine synthetase activity, required for endothelial cell migration during vascular development: acts by regulating membrane localization and activation of the GTPase RHOJ, possibly by promoting RHOJ palmitoylation. May act as a palmitoyltransferase for RHOJ: able to autopalmitoylate and then transfer the palmitoyl group to RHOJ. Plays a role in ribosomal 40S subunit biogenesis.

PTMs:

Palmitoylated; undergoes autopalmitoylation.

Ubiquitinated by ZNRF1.

Subcellular Location:

Cytoplasm>Cytosol. Microsome. Mitochondrion. Cell membrane>Lipid-anchor.
Note: Mainly localizes in the cytosol, with a fraction associated with the cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in endothelial cells.

Subunit Structure:

Decamer; composed of two pentamers. Interacts with PALMD (By similarity). Interacts with RHOJ.

Family&Domains:

Belongs to the glutamine synthetase family.

Research Fields

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Metabolism > Amino acid metabolism > Arginine biosynthesis.

· Metabolism > Amino acid metabolism > Alanine, aspartate and glutamate metabolism.

· Metabolism > Carbohydrate metabolism > Glyoxylate and dicarboxylate metabolism.

· Metabolism > Energy metabolism > Nitrogen metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Biosynthesis of amino acids.

· Organismal Systems > Nervous system > Glutamatergic synapse.

· Organismal Systems > Nervous system > GABAergic synapse.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.