AFfirm™ Prohibitin Mouse Monoclonal Antibody - #BF8085

(1)  
Product: Prohibitin Mouse Monoclonal Antibody
Catalog: BF8085
Description: Mouse monoclonal antibody to Prohibitin
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 30kDa; 30kD(Calculated).
Uniprot: P35232

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
WB 1:1000-1:10000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8085]
Specificity:
Prohibitin Antibody detects endogenous levels of total Prohibitin.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Epididymis luminal protein 215; Epididymis secretory sperm binding protein Li 54e; HEL 215; HEL S 54e; PHB; PHB_HUMAN; PHB1; Prohibitin;

Immunogens

Immunogen:

A synthesized peptide derived from human Prohibitin, corresponding to a region within the internal amino acids.

Uniprot:

P35232(PHB_HUMAN) >>Visit HPA database.

Gene(ID):
PHB(5245)
Expression:
P35232 PHB_HUMAN:

Widely expressed in different tissues.

Description:
The prohibitins, called PHB1 and PHB2, are highly conserved proteins that are present in multiple compartments in eukaryotic cells. PHB1 is 30kDa tumor suppressor protein involved in cell cycle control (1). PHB1 has been found in mitochondria, the nucleus and the plasma membrane, as well as extracellularly in circulation (2). In mitochondria prohibitins mainly exist as membrane-bound ring complexes and function as chaperones maintaining mitochondrial protein stability during protein synthesis and transportation (3,4). In the nucleus prohibitins interact with transcription factors such as Rb and p53 to regulate target gene transcription (2,5). Extracellular prohibitin can bind and activate C3 to enhance complement activation (6).
Sequence:
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

PTMs - P35232 As Substrate

Site PTM Type Enzyme
A2 Acetylation
K4 Acetylation
K4 Methylation
K4 Ubiquitination
K11 Methylation
R41 Methylation
S82 Phosphorylation
K83 Ubiquitination
T91 Phosphorylation
R93 Methylation
S101 Phosphorylation
T108 Phosphorylation
S109 Phosphorylation
Y114 Phosphorylation P06213 (INSR)
S121 O-Glycosylation
T123 Phosphorylation
K128 Acetylation
K128 Ubiquitination
S151 Phosphorylation
K177 Ubiquitination
K186 Ubiquitination
K202 Acetylation
K202 Ubiquitination
K207 Acetylation
K208 Ubiquitination
S213 Phosphorylation
S218 Phosphorylation
K219 Ubiquitination
K240 Ubiquitination
Y249 Phosphorylation
S252 Phosphorylation
S254 Phosphorylation
T258 O-Glycosylation
T258 Phosphorylation P31749 (AKT1)
Y259 Phosphorylation
S265 Phosphorylation

Research Backgrounds

Function:

Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.

Subcellular Location:

Mitochondrion inner membrane. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed in different tissues.

Subunit Structure:

Interacts with PHB2. Interacts with STOML2.

Family&Domains:

Belongs to the prohibitin family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.