AFfirm™ SULT1A1 Mouse Monoclonal Antibody - #BF8080
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Aryl sulfotransferase 1; HAST1/HAST2; Human aryl sulfotransferase mRNA complete cds; MGC131921; MGC5163; OTTHUMP00000162568; OTTHUMP00000162569; P PST 1; P PST; P-PST 1; Phenol sulfating phenol sulfotransferase 1; Phenol sulfotransferase 1; Phenol-sulfating phenol sulfotransferase 1; PST; ST1A1; ST1A1_HUMAN; ST1A3; STP; STP1; Sulfotransferase 1A1; Sulfotransferase family 1A phenol preferring member 1; Sulfotransferase family cytosolic 1A phenol preferring member 1; Sulfotransferase phenol preferring 1; SULT1A1; Thermostable phenol sulfotransferase; Thermostable phenol sulfotransferase1; Ts-PST; TSPST1;
Immunogens
- P50225 ST1A1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
PTMs - P50225 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K16 | Ubiquitination | Uniprot | |
S49 | Phosphorylation | Uniprot | |
K69 | Ubiquitination | Uniprot | |
K85 | Ubiquitination | Uniprot | |
T95 | Phosphorylation | Uniprot | |
K97 | Ubiquitination | Uniprot | |
K106 | Acetylation | Uniprot | |
K106 | Ubiquitination | Uniprot | |
T107 | Phosphorylation | Uniprot | |
K122 | Ubiquitination | Uniprot | |
K124 | Ubiquitination | Uniprot | |
S138 | Phosphorylation | Uniprot | |
Y140 | Phosphorylation | Uniprot | |
Y193 | Phosphorylation | Uniprot | |
K230 | Acetylation | Uniprot | |
K283 | Ubiquitination | Uniprot | |
S288 | Phosphorylation | Uniprot | |
S290 | Phosphorylation | Uniprot |
Research Backgrounds
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
Cytoplasm.
Liver, lung, adrenal, brain, platelets and skin.
Homodimer.
Belongs to the sulfotransferase 1 family.
Research Fields
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.