AFfirm™ Galectin 3 Mouse Monoclonal Antibody - #BF8044
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
35 kDa lectin; Carbohydrate binding protein 35; Carbohydrate-binding protein 35; CBP 35; CBP35; Gal-3; GAL3; Galactose-specific lectin 3; Galactoside-binding protein; GALBP; Galectin 3 internal gene,included; Galectin-3; Galectin3; GALIG; GBP; IgE binding protein; IgE-binding protein; L 31; L 34; L-31; L-34 galactoside-binding lectin; L31; Laminin-binding protein; Lectin L-29; Lectin, galactose binding, soluble 3; LEG3_HUMAN; LGALS2; LGALS3; MAC 2 antigen; Mac-2; Mac-2 antigen; MAC2; Macrophage galactose-specific lectin; MGC105387;
Immunogens
A synthesized peptide derived from human Galectin 3, corresponding to a region within the internal amino acids.
A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes.
- P17931 LEG3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
PTMs - P17931 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S6 | Phosphorylation | P48729 (CSNK1A1) , P68400 (CSNK2A1) , P19784 (CSNK2A2) | Uniprot |
S12 | Phosphorylation | P68400 (CSNK2A1) , P19784 (CSNK2A2) , P48729 (CSNK1A1) | Uniprot |
Y79 | Phosphorylation | P00519 (ABL1) , P42684 (ABL2) | Uniprot |
S96 | Phosphorylation | Uniprot | |
Y107 | Phosphorylation | P00519 (ABL1) | Uniprot |
Y118 | Phosphorylation | P00519 (ABL1) , P42684 (ABL2) | Uniprot |
T133 | Phosphorylation | Uniprot | |
T175 | Phosphorylation | Uniprot | |
K176 | Acetylation | Uniprot | |
K176 | Ubiquitination | Uniprot | |
S188 | Phosphorylation | Uniprot | |
K196 | Ubiquitination | Uniprot | |
K210 | Ubiquitination | Uniprot | |
Y221 | Phosphorylation | Uniprot | |
K227 | Ubiquitination | Uniprot |
Research Backgrounds
Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity). In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes.
Cytoplasm. Nucleus. Secreted.
Note: Secreted by a non-classical secretory pathway and associates with the cell surface.
A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes.
Probably forms homo- or heterodimers. Interacts with DMBT1 (By similarity). Interacts with CD6 and ALCAM. Forms a complex with the ITGA3, ITGB1 and CSPG4. Interacts with LGALS3BP, LYPD3, CYHR1 and UACA. Interacts with TRIM16; this interaction mediates autophagy of damage endomembranes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.