Product: Galectin 3 Mouse Monoclonal Antibody
Catalog: BF8044
Description: Mouse monoclonal antibody to Galectin 3
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Horse, Rabbit, Dog
Mol.Wt.: 27kDa; 26kD(Calculated).
Uniprot: P17931

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
IHC 1:50-1:200, WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8044(AFP21841)]
Specificity:
Galectin 3 Antibody detects endogenous levels of total Galectin 3.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

35 kDa lectin; Carbohydrate binding protein 35; Carbohydrate-binding protein 35; CBP 35; CBP35; Gal-3; GAL3; Galactose-specific lectin 3; Galactoside-binding protein; GALBP; Galectin 3 internal gene,included; Galectin-3; Galectin3; GALIG; GBP; IgE binding protein; IgE-binding protein; L 31; L 34; L-31; L-34 galactoside-binding lectin; L31; Laminin-binding protein; Lectin L-29; Lectin, galactose binding, soluble 3; LEG3_HUMAN; LGALS2; LGALS3; MAC 2 antigen; Mac-2; Mac-2 antigen; MAC2; Macrophage galactose-specific lectin; MGC105387;

Immunogens

Immunogen:

A synthesized peptide derived from human Galectin 3, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P17931 LEG3_HUMAN:

A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes.

Description:
galectin-3 galactose-specific lectin which binds IgE. Expressed at a high level in the colonic epithelium. Also abundant in activated macrophages.
Sequence:
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

PTMs - P17931 As Substrate

Site PTM Type Enzyme
S6 Phosphorylation P48729 (CSNK1A1) , P68400 (CSNK2A1) , P19784 (CSNK2A2)
S12 Phosphorylation P68400 (CSNK2A1) , P19784 (CSNK2A2) , P48729 (CSNK1A1)
Y79 Phosphorylation P00519 (ABL1) , P42684 (ABL2)
S96 Phosphorylation
Y107 Phosphorylation P00519 (ABL1)
Y118 Phosphorylation P00519 (ABL1) , P42684 (ABL2)
T133 Phosphorylation
T175 Phosphorylation
K176 Acetylation
K176 Ubiquitination
S188 Phosphorylation
K196 Ubiquitination
K210 Ubiquitination
Y221 Phosphorylation
K227 Ubiquitination

Research Backgrounds

Function:

Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity). In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes.

Subcellular Location:

Cytoplasm. Nucleus. Secreted.
Note: Secreted by a non-classical secretory pathway and associates with the cell surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes.

Subunit Structure:

Probably forms homo- or heterodimers. Interacts with DMBT1 (By similarity). Interacts with CD6 and ALCAM. Forms a complex with the ITGA3, ITGB1 and CSPG4. Interacts with LGALS3BP, LYPD3, CYHR1 and UACA. Interacts with TRIM16; this interaction mediates autophagy of damage endomembranes.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.