Product: HP1 gamma antibody
Catalog: BF0723
Description: Mouse monoclonal antibody to HP1 gamma
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 21 kDa; 21kD(Calculated).
Uniprot: Q13185
RRID: AB_2846205

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFB17793]
Specificity:
HP1 gamma mouse monoclonal antibody detects endogenous levels of HP1 gamma
RRID:
AB_2846205
Cite Format: Affinity Biosciences Cat# BF0723, RRID:AB_2846205.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CBX 3 antibody,CBX3 ;Chromobox homolog 3 ;Heterochromatin like protein 1;

Immunogens

Immunogen:

A synthetic peptide

Uniprot:
Gene(ID):
Sequence:
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ

PTMs - Q13185 As Substrate

Site PTM Type Enzyme
S3 Phosphorylation
K5 Acetylation
K5 Sumoylation
K5 Ubiquitination
K10 Acetylation
K10 Sumoylation
K10 Ubiquitination
K21 Acetylation
K21 Methylation
K21 Sumoylation
K21 Ubiquitination
K34 Acetylation
K34 Ubiquitination
K44 Acetylation
K44 Methylation
K44 Ubiquitination
K50 Acetylation
K50 Ubiquitination
K52 Ubiquitination
T55 Phosphorylation
T60 Phosphorylation
S79 Phosphorylation
K81 Ubiquitination
K84 Acetylation
K84 Ubiquitination
K86 Ubiquitination
T89 Phosphorylation
K92 Ubiquitination
S93 Phosphorylation P22612 (PRKACG) , P17612 (PRKACA) , P22694 (PRKACB)
S95 Phosphorylation
S97 Phosphorylation
S99 Phosphorylation
S102 Phosphorylation
K103 Acetylation
K103 Sumoylation
K103 Ubiquitination
S104 Phosphorylation
K105 Ubiquitination
K113 Ubiquitination
R119 Methylation
S132 Phosphorylation
S133 Phosphorylation
K143 Acetylation
K143 Methylation
K143 Ubiquitination
S145 Phosphorylation
K154 Ubiquitination
K159 Ubiquitination
T173 Phosphorylation
S176 Phosphorylation

Research Backgrounds

Function:

Seems to be involved in transcriptional silencing in heterochromatin-like complexes. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. May contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR). Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. Contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation, mediates the recruitment of the methyltransferases SUV39H1 and/or SUV39H2 by the PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1. Mediates the recruitment of NIPBL to sites of DNA damage at double-strand breaks (DSBs).

PTMs:

Phosphorylated by PIM1. Phosphorylated during interphase and possibly hyper-phosphorylated during mitosis.

Subcellular Location:

Nucleus.
Note: Associates with euchromatin and is largely excluded from constitutive heterochromatin. May be associated with microtubules and mitotic poles during mitosis (Potential).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Binds directly to CHAF1A. Interacts with histone H3 methylated at 'Lys-9'. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Interacts with INCENP, TRIM28/TIF1B, KMT5B, KMT5C and SP100. Interacts with TIF1A (By similarity). Interacts with MIS12 and DSN1. Can interact directly with CBX5 via the chromoshadow domain. Interacts with POGZ. Interacts with CHAMP1. The large PER complex involved in the histone methylation is composed of at least PER2, CBX3, TRIM28, SUV39H1 and/or SUV39H2; CBX3 mediates the formation of the complex. Interacts with INCENP. Interacts with NIPBL (via PxVxL motif). Interacts with LRIF1 (via PxVxL motif). Interacts with TTLL12.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.