Product: Bax Antibody
Catalog: AF0120
Source: Rabbit
Application: WB, IHC, IF/ICC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.: 21kD; 21kD(Calculated).
Uniprot: Q07812
RRID: AB_2833304

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB: 1:500-1:3000, IHC: 1:50-1:200, IF/ICC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Bax Antibody detects endogenous levels of total Bax.
RRID:
AB_2833304
Cite Format: Affinity Biosciences Cat# AF0120, RRID:AB_2833304.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apoptosis regulator BAX; BAX; Bax-protein; BAX_HUMAN; BAXA; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; Bcl-2-like protein 4; BCL2 associated X protein; BCL2 associated X protein omega; BCL2 associated X protein transcript variant delta2; Bcl2-L-4; BCL2L4; membrane isoform alpha;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q07812 BAX_HUMAN:

Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.

Description:
Bax Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Induces the release of cytochrome c, activation of CASP3, and thereby apoptosis. Belongs to the Bcl-2 family. Homodimer. Forms heterodimers with BCL2, E1B 19K protein, BCL2L1 isoform Bcl-X(L), MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). 8 isoforms of the human protein are produced by alternative splicing.
Sequence:
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Rabbit
100
Xenopus
70
Sheep
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q07812 As Substrate

Site PTM Type Enzyme
M1 Acetylation
R9 Methylation
S15 Phosphorylation
K21 Ubiquitination
T22 Phosphorylation
K57 Ubiquitination
K58 Ubiquitination
S60 Phosphorylation
K64 Ubiquitination
T85 Phosphorylation
S87 Phosphorylation
T135 Phosphorylation
T140 Phosphorylation
S163 Phosphorylation P49841 (GSK3B)
Y164 Phosphorylation
T167 Phosphorylation P27361 (MAPK3) , P28482 (MAPK1)
T172 Phosphorylation
T174 Phosphorylation
S184 Phosphorylation Q05513 (PRKCZ) , P31749 (AKT1)
T186 Phosphorylation

Research Backgrounds

Function:

Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein. Cytoplasm.
Note: Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.

Cytoplasm.

Cytoplasm.

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.

Subunit Structure:

Homodimer. Forms higher oligomers under stress conditions. Forms heterooligomers with BAK. Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX. Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells. Interacts with FAIM2/LFG2. Interacts with RTL10/BOP. Interacts (via a C-terminal 33 residues) with NOL3 (via CARD domain); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria. Interacts with GIMAP3/IAN4 and GIMAP5/IAN5; this interaction is increased, when cells initiate apoptosis upon IL2 withdrawal.

(Microbial infection) Interacts with adenovirus E1B 19K protein; this interaction blocks BAX oligomerization.

(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein vMIA/UL37.

(Microbial infection) Interacts with enterovirus protein 2B; this interaction activates BAX-induced apoptosis.

Family&Domains:

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Belongs to the Bcl-2 family.

Research Fields

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Colorectal cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Endometrial cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Thyroid cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway.   (View pathway)

· Organismal Systems > Nervous system > Neurotrophin signaling pathway.   (View pathway)

References

1). Li X et al. Upregulation of BCL-2 by acridone derivative through gene promoter i-motif for alleviating liver damage of NAFLD/NASH. Nucleic Acids Res 2020 Jul 25;gkaa615. (PubMed: 32710621) [IF=11.501]

Application: WB    Species: human    Sample: HepG2

Figure 4. Effect of A22 on anti-apoptosis in 0.5 mM palmitic acid oil (PA) induced cell model. (A) Effect of A22 on cell viability for anti-apoptotic protective effect. (B) Effect of A22 on transcription of BCL-2 and BAX with measurement of mRNA levels. (C) Effect of A22 on protein expressions related with apoptosis (left), which were quantitatively analyzed (right). All the experiments were repeated for three times.

2). Hou B et al. Reproductive toxicity of polystyrene microplastics: In vivo experimental study on testicular toxicity in mice. J Hazard Mater 2021 Mar 5;405:124028. (PubMed: 33087287) [IF=9.038]

Application: WB    Species: mice    Sample: testis tissue

Fig. 9. Bax and Bcl2 protein expression in the testis tissue mice by western blotting. The statistical chart shows the rate of Bax to Bcl2, which takes into account the balance of apoptosis and anti- apoptosis in testis. *P < 0.05, compared with the corresponding control, , $P < 0.05 compared with the M-Dose group.

3). Qiu M et al. Engineering Chemotherapeutic-Augmented Calcium Phosphate Nanoparticles for Treatment of Intraperitoneal Disseminated Ovarian Cancer. ACS Appl Mater Interfaces 2022 May 18;14(19):21954-21965. (PubMed: 35508299) [IF=8.758]

4). Guan Y et al. Smart dual responsive nanocarriers with reactive oxygen species amplification assisted synergistic chemotherapy against prostate cancer. J Colloid Interface Sci 2022 May 2;622:789-803. (PubMed: 35544966) [IF=7.489]

5). Wu H et al. LNC473 regulating APAF1 IRES-dependent translation via competitive sponging miR574 and miR15b: Implications in colorectal cancer. Mol Ther Nucleic Acids 2020 Sep 4;21:764-779. (PubMed: 32784109) [IF=7.032]

Application: WB    Species: Human    Sample: HCT116 and SW480 cells

Figure 6. LNC473-miR574/miR15b-APAF1 Signaling Axis in HCT116 and SW480 Cells (A) IF and ISH combination assay revealing the co-localization of APAF1 protein with included ncRNAs in HCT116 cells. Scale bars, 5 mm. (B and C) The levels of APAF1 mRNA (B) and protein (C) were determined after interfering LNC473 expression in HCT116 and SW480 cells by qPCR and IF assays. Scale bars, 20 mm. (D) The expression of apoptosis-related proteins including APAF1 was detected after interfering LNC473 expression in HCT116 and SW480 cells by western blot assay. (E and F) Rescue experiments showing the APAF1 levels in HCT116 and SW480 cells with exposure to the co-transfection of pcDH-LNC473 vector and miR574-5p or miR15b-5p mimic by qPCR (E) and western blot (F) assays. (G) Pattern diagram of APAF1-CDS and APAF1-IRES-CDS vectors. (H and I) APAF1 protein expression was determined in HCT116 and SW480 cells treated with APAF1-IRES-CDS vector, or pcDH-LNC473 and APAF1-IRES-CD co-transfection by western blot (H) and IF assays (I). Scale bars, 5 mm. (J) The percentage (%) of cell apoptosis in cells upon co-overexpressing APAF1-CDS or APAF1-IRE-CDS and LNC473 as assayed by flow cytometry. All tests were performed at least three times. Data were expressed as mean ± SD. ns (nonsignificant), p > 0.05; *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001.

6). Fan H et al. Bacteroides fragilis Strain ZY-312 Defense against Cronobacter sakazakii-Induced Necrotizing Enterocolitis In Vitro and in a Neonatal Rat Model. mSystems 2019 Aug 6;4(4) (PubMed: 31387931) [IF=6.633]

Application: WB    Species: rat    Sample: C. sakazakii-induced

FIG 4| ZY-312 reduces C. sakazakii-induced pyroptosis and apoptosis. (A and B) C. sakazakii-induced programmed cell death in HT-29 was ameliorated by pretreatment with ZY-312. Flow cytometry (A) and fluorescence microscope (B) were used to examine the results of staining of FITC and PI. (C) Western blot analysis shows that ZY-312 suppressed C. sakazakii-induced NEC by modulating apoptosis through caspase-3, Bax, and Bcl-2. -Actin was used as an indicator of protein loading.

7). Wang S et al. Long noncoding RNAs regulated spermatogenesis in varicocele‐induced spermatogenic dysfunction. Cell Prolif 2022 Mar 17;e13220. (PubMed: 35297519) [IF=5.753]

8). Fan X et al. Design, synthesis and biological evaluation of N-anthraniloyl tryptamine derivatives as pleiotropic molecules for the therapy of malignant glioma. Eur J Med Chem 2021 Oct 15;222:113564. (PubMed: 34091208) [IF=5.572]

Application: WB    Species: Human    Sample: U251 and U87MG cells.

Fig. 7. NP16 induces U87MG and U251 apoptosis and ROS generation at various concentrations (1, 2 and 4 mM). (A, B): images of apoptosis-related key protein (Bax, Bcl-2 and cytochrome c) expression levels of detected by western blotting method in U251 and U87MG cells. b-actin was used as an internal loading control. (CeF) Quantification of Bcl-2/Bax ratio and cytochrome c using ImageJ software. (G) Representative DCFH-DA fluorescence images of U251 and U87MG cells treated by NP16 at 1, 2 and 4 mM (magnification,  10, scale bar ¼ 500 mm). (HeI) Reactive ROS generation ratio qualified by DCFH-DA fluorescence density in U251 and U87MG using image J. All data are expressed as the mean ± SD pooled from three independent experiments. *P < 0.05, **P < 0.01, ***P < 0.001 when compared with the DMSO groups treated by equivalent amounts of DMSO.

9). Ma S et al. Melatonin derivatives combat with inflammation-related cancer by targeting the Main Culprit STAT3. Eur J Med Chem 2021 Feb 5;211:113027. (PubMed: 33248852) [IF=5.572]

Application: WB    Species: human    Sample: HCT-116 cells

Figure 10. (A) Compound P-3 triggered the explosion of ROS in HCT-116 cells. (magnification 20 ×, scale bar = 100 μm) (B) P-3 regulated the expression of proteins involved in Cyto-c/Caspase3 pathway. Data are presented as mean ± SD from three independent experiments. * P < 0.05, ** P<0.01, *** P<0.001 versus the control group.

10). Zhao M et al. Packaging cordycepin phycocyanin micelles for the inhibition of brain cancer. J Mater Chem B 2017 Aug 14;5(30):6016-6026. (PubMed: 32264358) [IF=5.344]

Application: WB    Species: Mouse    Sample: C6 cells

Fig. 4 Measured apoptosis and protein expression in C6 cells treated with (a) PBS, (b) Dextran, (c) Phycocyanin, (d) Cordycepin, (e) the Phycocyanin/Cordycepin mixture, or (f) Phy-Dex-Cord micelles for 24 h. (A) Trypan blue staining was used to observe cell morphology (Bar: 100 µm). (B) Apoptotic cells were detected with flow cytometry. Subcellular localization (C1) cleaved caspase-3 and (C2) cleaved PARP in C6 cells, as determined by Confocal laser scanning microscopy. (D1) Apoptosis-related protein, and (D2, D3) quantitative analysis of Bax, Bcl-2, p53, cleaved caspase-3, cleaved PARP, and PARP levels in C6 cells. Significant increase or decrease at labels (*) (p < 0.05), labels (**) (0.001< p < 0.01) and labels (***) p < 0.001, are identified in comparison with the Control group. (E) Cell counting determination of apoptotic rate with Trypan blue and statistical analysis of FCM results.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.