Product: Phospho-PKC-pan (Thr497) Antibody
Catalog: AF3197
Source: Rabbit
Application: WB, IHC, IF/ICC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 80kD; 77kD,78kD(Calculated).
Uniprot: P17252 | P05771 | P05129 | P24723
RRID: AB_2834629

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Phospho-PKC-pan (Thr497) Antibody detects endogenous levels of PKC-pan only when phosphorylated at Threonine 497.
RRID:
AB_2834629
Cite Format: Affinity Biosciences Cat# AF3197, RRID:AB_2834629.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AAG6; Aging associated gene 6; aPKC; KPCA_HUMAN; PKC alpha; PKC-A; PKC-alpha; PKCA; PRKACA; PRKCA; Protein Kinase C alpha; Protein kinase C alpha type; KPCG_HUMAN; MGC57564; OTTHUMP00000067291; PKC-gamma; PKCC; PKCG; PRKCG; Protein kinase C gamma; Protein kinase C gamma polypeptide; Protein kinase C gamma type; Protein kinase C, gamma; SCA 14; SCA14;

Immunogens

Immunogen:

A synthesized peptide derived from human PKC-pan around the phosphorylation site of Thr497.

Uniprot:
Gene(ID):
Expression:
P05129 KPCG_HUMAN:

Expressed in Purkinje cells of the cerebellar cortex.

P24723 KPCL_HUMAN:

Most abundant in lung, less in heart and skin.

Description:
Protein Kinase C (PKC) isoforms are serine/threonine kinases involved in signal transduction pathways that govern a wide range of physiological processes including differentiation, proliferation, gene expression, brain function, membrane transport and the organization of cytoskeletal and extracellular matrix proteins.
Sequence:
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV

MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV

MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM

MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRFGINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAVELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFSYVSPELQP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P17252/P05771/P05129/P24723 As Substrate

Site PTM Type Enzyme
A2 Acetylation
S11 Phosphorylation
T17 Phosphorylation
K23 Ubiquitination
T40 Phosphorylation
T48 Phosphorylation
S51 Phosphorylation
K76 Ubiquitination
K91 Ubiquitination
Y123 Phosphorylation
T134 Phosphorylation
K141 Ubiquitination
S149 Phosphorylation
Y195 Phosphorylation
K197 Acetylation
K197 Ubiquitination
K199 Ubiquitination
S206 Phosphorylation
K216 Ubiquitination
T226 Phosphorylation
K232 Ubiquitination
S241 Phosphorylation
S311 Phosphorylation
T314 Phosphorylation
K315 Ubiquitination
K327 Ubiquitination
K350 Ubiquitination
S352 Phosphorylation
K362 Ubiquitination
T364 Phosphorylation
Y368 Phosphorylation
K391 Ubiquitination
K468 Ubiquitination
S476 Phosphorylation
K481 Ubiquitination
K489 Ubiquitination
T497 Phosphorylation
T498 Phosphorylation
K499 Ubiquitination
T500 Phosphorylation P53004 (BLVRA) , O15530 (PDPK1)
T504 Phosphorylation
Y507 Phosphorylation
Y515 Phosphorylation
K566 Ubiquitination
K595 Ubiquitination
T642 Phosphorylation P05771 (PRKCB)
T644 Phosphorylation
S661 Phosphorylation P05771 (PRKCB)
Y662 Phosphorylation P43405 (SYK)
Site PTM Type Enzyme
A2 Acetylation
S10 Phosphorylation
T11 Phosphorylation
S13 Phosphorylation
K38 Ubiquitination
T48 Phosphorylation
S51 Phosphorylation
K76 Ubiquitination
K91 Ubiquitination
K105 Acetylation
K158 Ubiquitination
K165 Ubiquitination
K172 Acetylation
K172 Ubiquitination
T176 Phosphorylation
Y195 Phosphorylation
K197 Acetylation
K197 Ubiquitination
K199 Ubiquitination
K205 Ubiquitination
S208 Phosphorylation
T214 Phosphorylation
S226 Phosphorylation Q13188 (STK3)
T228 Phosphorylation Q13188 (STK3)
K230 Ubiquitination
S234 Phosphorylation
S241 Phosphorylation
Y285 Phosphorylation
Y286 Phosphorylation
K309 Ubiquitination
K316 Ubiquitination
S319 Phosphorylation
S321 Phosphorylation
K325 Ubiquitination
T337 Phosphorylation
K347 Ubiquitination
S349 Phosphorylation
K352 Ubiquitination
K359 Ubiquitination
T361 Phosphorylation
Y365 Phosphorylation
K368 Ubiquitination
K388 Ubiquitination
K465 Ubiquitination
S473 Phosphorylation
K478 Ubiquitination
K486 Ubiquitination
T494 Phosphorylation
T495 Phosphorylation
T497 Phosphorylation
T501 Phosphorylation
Y504 Phosphorylation
Y512 Phosphorylation
K570 Acetylation
K575 Ubiquitination
K604 Acetylation
K604 Ubiquitination
K615 Ubiquitination
K621 Ubiquitination
K628 Acetylation
K628 Ubiquitination
T638 Phosphorylation P28482 (MAPK1) , P17252 (PRKCA)
S651 Phosphorylation
S657 Phosphorylation P17252 (PRKCA) , Q05513 (PRKCZ)
Y658 Phosphorylation P43405 (SYK)
S670 Phosphorylation
Site PTM Type Enzyme
S109 Phosphorylation
S145 Phosphorylation
S148 Phosphorylation
T155 Phosphorylation
Y195 Phosphorylation
K197 Acetylation
K197 Ubiquitination
S264 Phosphorylation
S320 Phosphorylation
S342 Phosphorylation
K359 Acetylation
K359 Ubiquitination
S361 Phosphorylation
K503 Acetylation
T510 Phosphorylation
T511 Phosphorylation
T512 Phosphorylation
T514 Phosphorylation
T518 Phosphorylation
Y521 Phosphorylation
Y529 Phosphorylation
T655 Phosphorylation
T674 Phosphorylation
Site PTM Type Enzyme
T25 Phosphorylation
S28 Phosphorylation P24723 (PRKCH)
S32 Phosphorylation P24723 (PRKCH)
K36 Ubiquitination
Y94 Phosphorylation
K152 Ubiquitination
T183 Phosphorylation
K234 Ubiquitination
S249 Phosphorylation
S317 Phosphorylation
S320 Phosphorylation
K321 Ubiquitination
S324 Phosphorylation
S326 Phosphorylation
K337 Ubiquitination
K363 Ubiquitination
S365 Phosphorylation
K375 Ubiquitination
K384 Ubiquitination
K388 Ubiquitination
K404 Ubiquitination
K481 Ubiquitination
K494 Ubiquitination
T513 Phosphorylation
K591 Ubiquitination
S599 Phosphorylation
T601 Phosphorylation
K615 Ubiquitination
T656 Phosphorylation
S675 Phosphorylation
Y676 Phosphorylation

PTMs - P17252/P05771/P05129/P24723 As Enzyme

Substrate Site Source
O15350 (TP73) S388 Uniprot
O15519 (CFLAR) S193 Uniprot
O95786 (DDX58) S8 Uniprot
O95786 (DDX58) T170 Uniprot
P04004 (VTN) S381 Uniprot
P04049 (RAF1) S497 Uniprot
P04049 (RAF1) S619 Uniprot
P04083 (ANXA1) S27 Uniprot
P04083 (ANXA1) S28 Uniprot
P05107 (ITGB2) S745 Uniprot
P05107 (ITGB2) T758 Uniprot
P05771-2 (PRKCB) S16 Uniprot
P05771-2 (PRKCB) T17 Uniprot
P05771-1 (PRKCB) T635 Uniprot
P05771 (PRKCB) T642 Uniprot
P05771-2 (PRKCB) S660 Uniprot
P05771 (PRKCB) S661 Uniprot
P06127 (CD5) T434 Uniprot
P06127 (CD5) T436 Uniprot
P06400 (RB1) S249 Uniprot
P06400 (RB1) T252 Uniprot
P06400 (RB1) S780 Uniprot
P06400 (RB1) S795 Uniprot
P06400 (RB1) T821 Uniprot
P06730-1 (EIF4E) S209 Uniprot
P07355-1 (ANXA2) S2 Uniprot
P07355-2 (ANXA2) S20 Uniprot
P07355 (ANXA2) S26 Uniprot
P10636-8 (MAPT) S258 Uniprot
P10636-8 (MAPT) S293 Uniprot
P10636-8 (MAPT) S324 Uniprot
P10636-8 (MAPT) S352 Uniprot
P11171-4 (EPB41) S312 Uniprot
P11388 (TOP2A) S29 Uniprot
P11473 (VDR) S51 Uniprot
P14598 (NCF1) S303 Uniprot
P14598 (NCF1) S304 Uniprot
P14598 (NCF1) S315 Uniprot
P14598 (NCF1) S320 Uniprot
P14598 (NCF1) S328 Uniprot
P14598 (NCF1) S359 Uniprot
P14598 (NCF1) S370 Uniprot
P14598 (NCF1) S379 Uniprot
P14679 (TYR) S523 Uniprot
P14679 (TYR) S527 Uniprot
P15336 (ATF2) S121 Uniprot
P16949 (STMN1) S25 Uniprot
P16949 (STMN1) S38 Uniprot
P17302 (GJA1) S368 Uniprot
P17677-1 (GAP43) S41 Uniprot
P19429 (TNNI3) S42 Uniprot
P19429 (TNNI3) S44 Uniprot
P19429 (TNNI3) T143 Uniprot
P19484 (TFEB) S462 Uniprot
P19484 (TFEB) S463 Uniprot
P19484 (TFEB) S467 Uniprot
P19484 (TFEB) S469 Uniprot
P20700 (LMNB1) S395 Uniprot
P20700 (LMNB1) S405 Uniprot
P21730 (C5AR1) S334 Uniprot
P26010-1 (ITGB7) T783 Uniprot
P28329-3 (CHAT) T255 Uniprot
P28329-3 (CHAT) S346 Uniprot
P28329-3 (CHAT) S347 Uniprot
P28329 (CHAT) T373 Uniprot
P28329-3 (CHAT) S440 Uniprot
P28329 (CHAT) S464 Uniprot
P28329 (CHAT) S465 Uniprot
P28329-3 (CHAT) S476 Uniprot
P28329 (CHAT) S558 Uniprot
P28329 (CHAT) S594 Uniprot
P28799 (GRN) S81 Uniprot
P29353 (SHC1) S36 Uniprot
P29474 (NOS3) T495 Uniprot
P29966 (MARCKS) S159 Uniprot
P29966 (MARCKS) S163 Uniprot
P29966 (MARCKS) S170 Uniprot
P30086 (PEBP1) S153 Uniprot
P31749 (AKT1) T308 Uniprot
P31749 (AKT1) S473 Uniprot
P34741 (SDC2) S187 Uniprot
P34741 (SDC2) S188 Uniprot
P35548 (MSX2) T135 Uniprot
P35548 (MSX2) T141 Uniprot
P35568 (IRS1) S323 Uniprot
P35568 (IRS1) S441 Uniprot
P35637 (FUS) S257 Uniprot
P41180 (CASR) T888 Uniprot
P41594-2 (GRM5) S840 Uniprot
P43629 (KIR3DL1) S415 Uniprot
P48736 (PIK3CG) S582 Uniprot
P49768 (PSEN1) S346 Uniprot
P49840 (GSK3A) S21 Uniprot
P49841 (GSK3B) S9 Uniprot
P55042 (RRAD) S214 Uniprot
P55042 (RRAD) S257 Uniprot
P55042 (RRAD) S290 Uniprot
P55042 (RRAD) S299 Uniprot
P56537-2 (EIF6) T215 Uniprot
P56537-1 (EIF6) T234 Uniprot
P56537 (EIF6) S235 Uniprot
P61764-1 (STXBP1) S306 Uniprot
P61764-2 (STXBP1) S313 Uniprot
P62491 (RAB11A) S177 Uniprot
P98082 (DAB2) S24 Uniprot
Q01844 (EWSR1) S266 Uniprot
Q03721 (KCNC4) S8 Uniprot
Q03721 (KCNC4) S9 Uniprot
Q03721 (KCNC4) S15 Uniprot
Q03721 (KCNC4) S21 Uniprot
Q05639 (EEF1A2) S53 Uniprot
Q06124-2 (PTPN11) S576 Uniprot
Q06124 (PTPN11) S580 Uniprot
Q06124 (PTPN11) S595 Uniprot
Q06187 (BTK) S180 Uniprot
Q07869 (PPARA) S179 Uniprot
Q07869 (PPARA) S230 Uniprot
Q12906 (ILF3) S647 Uniprot
Q13224 (GRIN2B) S1303 Uniprot
Q13224 (GRIN2B) S1323 Uniprot
Q14847 (LASP1) S146 Uniprot
Q16236 (NFE2L2) S40 Uniprot
Q16625-1 (OCLN) S340 Uniprot
Q16625 (OCLN) S490 Uniprot
Q5JVS0-1 (HABP4) T354 Uniprot
Q5JVS0 (HABP4) T375 Uniprot
Q5T7P8 (SYT6) T283 Uniprot
Q5T7P8 (SYT6) T417 Uniprot
Q5T7P8 (SYT6) T418 Uniprot
Q8NER1 (TRPV1) T705 Uniprot
Q92686 (NRGN) S36 Uniprot
Q96D31 (ORAI1) S27 Uniprot
Q96D31 (ORAI1) S30 Uniprot
Q96PH1-4 (NOX5) T494 Uniprot
Q96PH1-4 (NOX5) S498 Uniprot
Q99418-2 (CYTH2) S391 Uniprot
Q99418-1 (CYTH2) S392 Uniprot
Q9BXL7 (CARD11) S559 Uniprot
Q9BXL7 (CARD11) S644 Uniprot
Q9BXL7 (CARD11) S652 Uniprot
Q9H1D0 (TRPV6) S184 Uniprot
Q9H1D0 (TRPV6) T728 Uniprot
Q9P2D0 (IBTK) S1200 Uniprot
Q9P2D0 (IBTK) S1203 Uniprot
Q9UBS0 (RPS6KB2) S473 Uniprot
Q9UBU3 (GHRL) S41 Uniprot
Q9UQ80-1 (PA2G4) S363 Uniprot
Q9UQ80-1 (PA2G4) T366 Uniprot
Q9Y4H2 (IRS2) S306 Uniprot
Q9Y4H2 (IRS2) S679 Uniprot
Substrate Site Source
A0A024R2E4 (ATP2B2) T1094 Uniprot
O00161 (SNAP23) S23 Uniprot
O00161-1 (SNAP23) T24 Uniprot
O00161-2 (SNAP23) S108 Uniprot
O00161 (SNAP23) S161 Uniprot
O00168 (FXYD1) S88 Uniprot
O14493 (CLDN4) S194 Uniprot
O14745 (SLC9A3R1) S77 Uniprot
O14745 (SLC9A3R1) S162 Uniprot
O14745 (SLC9A3R1) S339 Uniprot
O14745 (SLC9A3R1) S340 Uniprot
O14920 (IKBKB) S177 Uniprot
O14920 (IKBKB) S181 Uniprot
O14939 (PLD2) S243 Uniprot
O14939 (PLD2) T252 Uniprot
O14950 (MYL12B) T10 Uniprot
O14950 (MYL12B) T19 Uniprot
O14950 (MYL12B) S20 Uniprot
O14986 (PIP5K1B) S413 Uniprot
O15217 (GSTA4) T193 Uniprot
O15350 (TP73) S388 Uniprot
O15519-2 (CFLAR) S193 Uniprot
O43526-4 (KCNQ2) S520 Uniprot
O43526-3 (KCNQ2) S523 Uniprot
O43526-4 (KCNQ2) S527 Uniprot
O43526-3 (KCNQ2) S530 Uniprot
O43526-2 (KCNQ2) S533 Uniprot
O43526-2 (KCNQ2) S540 Uniprot
O43526-1 (KCNQ2) S551 Uniprot
O43526-1 (KCNQ2) S558 Uniprot
O60479 (DLX3) T134 Uniprot
O60479 (DLX3) S137 Uniprot
O60479 (DLX3) S138 Uniprot
O60479 (DLX3) S182 Uniprot
O60500 (NPHS1) T1120 Uniprot
O60500 (NPHS1) T1125 Uniprot
O60716 (CTNND1) S879 Uniprot
O60825-1 (PFKFB2) T475 Uniprot
O60869-2 (EDF1) T91 Uniprot
O60928 (KCNJ13) S201 Uniprot
O60941 (DTNB) T69 Uniprot
O60941 (DTNB) T179 Uniprot
O60941 (DTNB) T212 Uniprot
O75376 (NCOR1) S70 Uniprot
O75469 (NR1I2) T408 Uniprot
O75689-1 (ADAP1) S87 Uniprot
O75689 (ADAP1) T276 Uniprot
O76090 (BEST1) S358 Uniprot
O94759-3 (TRPM2) S39 Uniprot
O94806 (PRKD3) S731 Uniprot
O94992 (HEXIM1) S158 Uniprot
O95243 (MBD4) S165 Uniprot
O95243 (MBD4) S262 Uniprot
O95471 (CLDN7) S204 Uniprot
O95644-5 (NFATC1) S232 Uniprot
O95644-2 (NFATC1) S245 Uniprot
O95644-5 (NFATC1) S256 Uniprot
O95644-4 (NFATC1) S269 Uniprot
O95644-5 (NFATC1) S281 Uniprot
O95644-4 (NFATC1) S294 Uniprot
O95786 (DDX58) S8 Uniprot
O95786 (DDX58) T170 Uniprot
O96004 (HAND1) S98 Uniprot
O96004 (HAND1) T107 Uniprot
O96004 (HAND1) S109 Uniprot
P00533 (EGFR) T678 Uniprot
P00749 (PLAU) S158 Uniprot
P00749 (PLAU) S323 Uniprot
P01116-2 (KRAS) S181 Uniprot
P01589 (IL2RA) S268 Uniprot
P01589 (IL2RA) T271 Uniprot
P01730 (CD4) S433 Uniprot
P01730 (CD4) S440 Uniprot
P02545-2 (LMNA) T19 Uniprot
P02545-3 (LMNA) S403 Uniprot
P02545-2 (LMNA) S404 Uniprot
P02545-2 (LMNA) S525 Uniprot
P02686-4 (MBP) S8 Uniprot
P02686-6 (MBP) S13 Uniprot
P02686-3 (MBP) S57 Uniprot
P02686-5 (MBP) S116 Uniprot
P02686-6 (MBP) S122 Uniprot
P02686-5 (MBP) S133 Uniprot
P02686-1 (MBP) S141 Uniprot
P02686-3 (MBP) S142 Uniprot
P02686-1 (MBP) S146 Uniprot
P02686-4 (MBP) S148 Uniprot
P02686-6 (MBP) S151 Uniprot
P02686-5 (MBP) S152 Uniprot
P02686-3 (MBP) S159 Uniprot
P02686-5 (MBP) S162 Uniprot
P02686-4 (MBP) S167 Uniprot
P02686-4 (MBP) S177 Uniprot
P02686-3 (MBP) S178 Uniprot
P02686-3 (MBP) S188 Uniprot
P02686-1 (MBP) S190 Uniprot
P02686-1 (MBP) S249 Uniprot
P02686-1 (MBP) S266 Uniprot
P02686-1 (MBP) S285 Uniprot
P02686-1 (MBP) S295 Uniprot
P02786 (TFRC) S24 Uniprot
P04004 (VTN) S381 Uniprot
P04004 (VTN) S386 Uniprot
P04004 (VTN) S393 Uniprot
P04004 (VTN) S397 Uniprot
P04049 (RAF1) S43 Uniprot
P04049 (RAF1) S233 Uniprot
P04049 (RAF1) S497 Uniprot
P04049 (RAF1) S499 Uniprot
P04049 (RAF1) S619 Uniprot
P04083 (ANXA1) S27 Uniprot
P04083 (ANXA1) S28 Uniprot
P04439 (HLA-A) S359 Uniprot
P04626 (ERBB2) T686 Uniprot
P04637-1 (TP53) S371 Uniprot
P04637 (TP53) S376 Uniprot
P04637 (TP53) T377 Uniprot
P04637-1 (TP53) S378 Uniprot
P05107 (ITGB2) S745 Uniprot
P05107 (ITGB2) T758 Uniprot
P05107 (ITGB2) T760 Uniprot
P05114 (HMGN1) S7 Uniprot
P05114 (HMGN1) S21 Uniprot
P05114 (HMGN1) S25 Uniprot
P05204 (HMGN2) S25 Uniprot
P05204 (HMGN2) S29 Uniprot
P05556 (ITGB1) S785 Uniprot
P05783 (KRT18) S53 Uniprot
P06127 (CD5) T434 Uniprot
P06127 (CD5) T436 Uniprot
P06213 (INSR) S1062 Uniprot
P06213 (INSR) S1064 Uniprot
P06213-1 (INSR) T1362 Uniprot
P06239 (LCK) S42 Uniprot
P06730-1 (EIF4E) S209 Uniprot
P07355 (ANXA2) S12 Uniprot
P07355-1 (ANXA2) S26 Uniprot
P07355-2 (ANXA2) S44 Uniprot
P07949 (RET) T675 Uniprot
P08034 (GJB1) S229 Uniprot
P08034 (GJB1) S233 Uniprot
P08100 (RHO) S334 Uniprot
P08100 (RHO) T336 Uniprot
P08183 (ABCB1) S661 Uniprot
P08183 (ABCB1) S667 Uniprot
P08183 (ABCB1) S671 Uniprot
P08253 (MMP2) S160 Uniprot
P08253 (MMP2) T250 Uniprot
P08253 (MMP2) S365 Uniprot
P08253 (MMP2) T377 Uniprot
P08253 (MMP2) T378 Uniprot
P08567 (PLEK) S113 Uniprot
P08567 (PLEK) S117 Uniprot
P08581 (MET) S985 Uniprot
P08670 (VIM) S5 Uniprot
P08670 (VIM) S7 Uniprot
P08670 (VIM) S8 Uniprot
P08670 (VIM) S9 Uniprot
P08670 (VIM) S10 Uniprot
P08670 (VIM) S25 Uniprot
P08670 (VIM) S26 Uniprot
P08670 (VIM) S34 Uniprot
P08670 (VIM) S39 Uniprot
P08670 (VIM) S42 Uniprot
P08684 (CYP3A4) T92 Uniprot
P08684 (CYP3A4) S100 Uniprot
P08684 (CYP3A4) T103 Uniprot
P08684 (CYP3A4) S116 Uniprot
P08684 (CYP3A4) S119 Uniprot
P08684 (CYP3A4) S131 Uniprot
P08684 (CYP3A4) S134 Uniprot
P08684 (CYP3A4) T136 Uniprot
P08684 (CYP3A4) S139 Uniprot
P08684 (CYP3A4) S259 Uniprot
P08684 (CYP3A4) T264 Uniprot
P08684 (CYP3A4) T284 Uniprot
P08684 (CYP3A4) S398 Uniprot
P08684 (CYP3A4) S420 Uniprot
P08833 (IGFBP1) S126 Uniprot
P08833 (IGFBP1) S144 Uniprot
P08833 (IGFBP1) S194 Uniprot
P09211 (GSTP1) S185 Uniprot
P09651 (HNRNPA1) S95 Uniprot
P09693 (CD3G) S148 Uniprot
P09758 (TACSTD2) S303 Uniprot
P10275 (AR) S579 Uniprot
P10415-1 (BCL2) S24 Uniprot
P10415 (BCL2) S70 Uniprot
P10451-5 (SPP1) S148 Uniprot
P10588 (NR2F6) S83 Uniprot
P10599 (TXN) T100 Uniprot
P10636-8 (MAPT) S258 Uniprot
P10636-8 (MAPT) S293 Uniprot
P10636-8 (MAPT) S305 Uniprot
P10636-8 (MAPT) S324 Uniprot
P10636-8 (MAPT) S352 Uniprot
P10721-1 (KIT) S741 Uniprot
P10721 (KIT) S746 Uniprot
P10721-1 (KIT) S821 Uniprot
P10721-1 (KIT) S959 Uniprot
P11234 (RALB) S198 Uniprot
P11387 (TOP1) S21 Uniprot
P11388-1 (TOP2A) S29 Uniprot
P11473 (VDR) S51 Uniprot
P11831 (SRF) T159 Uniprot
P11831 (SRF) S162 Uniprot
P12931-1 (SRC) S12 Uniprot
P13498 (CYBA) T147 Uniprot
P13569 (CFTR) S660 Uniprot
P13569-1 (CFTR) S686 Uniprot
P13569 (CFTR) S737 Uniprot
P13569-1 (CFTR) S790 Uniprot
P13569 (CFTR) S795 Uniprot
P13569 (CFTR) S813 Uniprot
P13726 (F3) S285 Uniprot
P13726 (F3) S290 Uniprot
P14136-1 (GFAP) S13 Uniprot
P14136-1 (GFAP) S17 Uniprot
P14136-1 (GFAP) S38 Uniprot
P14598 (NCF1) S303 Uniprot
P14598 (NCF1) S304 Uniprot
P14598 (NCF1) S315 Uniprot
P14598 (NCF1) S320 Uniprot
P14598 (NCF1) S328 Uniprot
P14598 (NCF1) S359 Uniprot
P14598 (NCF1) S370 Uniprot
P14598 (NCF1) S379 Uniprot
P15172 (MYOD1) T115 Uniprot
P15311 (EZR) T567 Uniprot
P15336 (ATF2) S121 Uniprot
P15382 (KCNE1) S102 Uniprot
P16070 (CD44) S672 Uniprot
P16144 (ITGB4) S1356 Uniprot
P16144 (ITGB4) S1360 Uniprot
P16144 (ITGB4) S1364 Uniprot
P16144 (ITGB4) S1494 Uniprot
P16150 (SPN) S351 Uniprot
P16671 (CD36) T92 Uniprot
P17252 (PRKCA) T638 Uniprot
P17252 (PRKCA) S657 Uniprot
P17302 (GJA1) S262 Uniprot
P17302 (GJA1) S368 Uniprot
P17812 (CTPS1) T455 Uniprot
P17812 (CTPS1) S462 Uniprot
P17844-1 (DDX5) S557 Uniprot
P18031 (PTPN1) S378 Uniprot
P18206-2 (VCL) S1033 Uniprot
P18206-2 (VCL) S1045 Uniprot
P18206-1 (VCL) S1101 Uniprot
P18206-1 (VCL) S1113 Uniprot
P18507-2 (GABRG2) S366 Uniprot
P18507-3 (GABRG2) S406 Uniprot
P19021-2 (PAM) S822 Uniprot
P19021-2 (PAM) S827 Uniprot
P19021-4 (PAM) S843 Uniprot
P19021-4 (PAM) S848 Uniprot
P19021-3 (PAM) S861 Uniprot
P19021-3 (PAM) S866 Uniprot
P19021-5 (PAM) S930 Uniprot
P19021-5 (PAM) S935 Uniprot
P19086 (GNAZ) S16 Uniprot
P19086 (GNAZ) S27 Uniprot
P19174 (PLCG1) S1248 Uniprot
P19429 (TNNI3) S23 Uniprot
P19429 (TNNI3) S24 Uniprot
P19429 (TNNI3) S42 Uniprot
P19429 (TNNI3) S44 Uniprot
P19429 (TNNI3) S77 Uniprot
P19429 (TNNI3) T143 Uniprot
P19429 (TNNI3) S199 Uniprot
P20020-3 (ATP2B1) T1116 Uniprot
P21359-2 (NF1) S2808 Uniprot
P21399 (ACO1) S138 Uniprot
P21399 (ACO1) S711 Uniprot
P21730 (C5AR1) S314 Uniprot
P21730 (C5AR1) S317 Uniprot
P21730 (C5AR1) S327 Uniprot
P21730 (C5AR1) S332 Uniprot
P21730 (C5AR1) S334 Uniprot
P21730 (C5AR1) S338 Uniprot
P21731 (TBXA2R) S324 Uniprot
P21731 (TBXA2R) S329 Uniprot
P21731 (TBXA2R) S331 Uniprot
P21731 (TBXA2R) T337 Uniprot
P21731-2 (TBXA2R) T399 Uniprot
P22460 (KCNA5) T15 Uniprot
P22681 (CBL) S619 Uniprot
P22681 (CBL) S623 Uniprot
P22681 (CBL) S639 Uniprot
P22681 (CBL) S642 Uniprot
P23528 (CFL1) S23 Uniprot
P23528 (CFL1) S24 Uniprot
P23677 (ITPKA) T311 Uniprot
P24046-1 (GABRR1) S431 Uniprot
P24046-1 (GABRR1) S440 Uniprot
P24046-1 (GABRR1) S443 Uniprot
P24046-1 (GABRR1) S444 Uniprot
P24046-1 (GABRR1) S447 Uniprot
P24844 (MYL9) S2 Uniprot
P24844 (MYL9) S3 Uniprot
P24844 (MYL9) T10 Uniprot
P25098 (GRK2) S29 Uniprot
P28329-3 (CHAT) T255 Uniprot
P28329-3 (CHAT) S346 Uniprot
P28329-3 (CHAT) S347 Uniprot
P28329 (CHAT) T373 Uniprot
P28329-3 (CHAT) S440 Uniprot
P28329 (CHAT) S464 Uniprot
P28329 (CHAT) S465 Uniprot
P28329-3 (CHAT) S476 Uniprot
P28329 (CHAT) S558 Uniprot
P28329 (CHAT) S594 Uniprot
P29350-1 (PTPN6) S591 Uniprot
P29353-7 (SHC1) S29 Uniprot
P29353-1 (SHC1) S139 Uniprot
P29474 (NOS3) T495 Uniprot
P29475-1 (NOS1) S852 Uniprot
P29966 (MARCKS) S27 Uniprot
P29966 (MARCKS) S46 Uniprot
P29966 (MARCKS) S81 Uniprot
P29966 (MARCKS) S101 Uniprot
P29966 (MARCKS) S118 Uniprot
P29966 (MARCKS) S159 Uniprot
P29966 (MARCKS) S163 Uniprot
P29966 (MARCKS) S167 Uniprot
P29966 (MARCKS) S170 Uniprot
P29972 (AQP1) T157 Uniprot
P29972 (AQP1) T239 Uniprot
P30086 (PEBP1) S153 Uniprot
P30411 (BDKRB2) S373 Uniprot
P30622 (CLIP1) S312 Uniprot
P31431-1 (SDC4) S179 Uniprot
P31645 (SLC6A4) S149 Uniprot
P31645 (SLC6A4) S277 Uniprot
P31645 (SLC6A4) T603 Uniprot
P31749 (AKT1) T308 Uniprot
P31749 (AKT1) S473 Uniprot
P32004 (L1CAM) T1172 Uniprot
P34741 (SDC2) S187 Uniprot
P34741 (SDC2) S188 Uniprot
P35367 (HRH1) S396 Uniprot
P35367 (HRH1) S398 Uniprot
P35367 (HRH1) T478 Uniprot
P35368 (ADRA1B) S396 Uniprot
P35368 (ADRA1B) S402 Uniprot
P35368 (ADRA1B) S406 Uniprot
P35368 (ADRA1B) S410 Uniprot
P35368 (ADRA1B) S412 Uniprot
P35398 (RORA) S35 Uniprot
P35568 (IRS1) S24 Uniprot
P35579 (MYH9) S1916 Uniprot
P35611 (ADD1) S716 Uniprot
P35611 (ADD1) S726 Uniprot
P35612 (ADD2) S713 Uniprot
P35612 (ADD2) S726 Uniprot
P35869 (AHR) S12 Uniprot
P35869 (AHR) S36 Uniprot
P35900 (KRT20) S13 Uniprot
P36542 (ATP5F1C) S146 Uniprot
P36897 (TGFBR1) T200 Uniprot
P37802 (TAGLN2) S11 Uniprot
P37802 (TAGLN2) T180 Uniprot
P37802 (TAGLN2) S185 Uniprot
P38936 (CDKN1A) S146 Uniprot
P38936 (CDKN1A) S153 Uniprot
P41091 (EIF2S3) T66 Uniprot
P41143 (OPRD1) S344 Uniprot
P41180 (CASR) T888 Uniprot
P41594-2 (GRM5) S840 Uniprot
P41594-2 (GRM5) T841 Uniprot
P42261 (GRIA1) S832 Uniprot
P42261 (GRIA1) S834 Uniprot
P42261 (GRIA1) S836 Uniprot
P42261-1 (GRIA1) S849 Uniprot
P42262 (GRIA2) S683 Uniprot
P42262 (GRIA2) S717 Uniprot
P42262 (GRIA2) S880 Uniprot
P43119 (PTGIR) S328 Uniprot
P43629 (KIR3DL1) S415 Uniprot
P45379 (TNNT2) S189 Uniprot
P45379-11 (TNNT2) T200 Uniprot
P45379-6 (TNNT2) T203 Uniprot
P45379 (TNNT2) T204 Uniprot
P45379-10 (TNNT2) T210 Uniprot
P45379-11 (TNNT2) T281 Uniprot
P45379-6 (TNNT2) T284 Uniprot
P45379-10 (TNNT2) T291 Uniprot
P46940 (IQGAP1) S1443 Uniprot
P48048 (KCNJ1) S4 Uniprot
P48048 (KCNJ1) S201 Uniprot
P48050 (KCNJ4) T53 Uniprot
P48058 (GRIA4) T850 Uniprot
P48058 (GRIA4) S862 Uniprot
P48067-2 (SLC6A9) T19 Uniprot
P48067-2 (SLC6A9) S239 Uniprot
P48067-2 (SLC6A9) T276 Uniprot
P48067-2 (SLC6A9) T590 Uniprot
P48067-2 (SLC6A9) S625 Uniprot
P49768 (PSEN1) S346 Uniprot
P49795 (RGS19) S24 Uniprot
P49795 (RGS19) T201 Uniprot
P49802-5 (RGS7) S434 Uniprot
P49840 (GSK3A) S21 Uniprot
P49841 (GSK3B) S9 Uniprot
P50552 (VASP) S157 Uniprot
P51674-1 (GPM6A) T10 Uniprot
P52565 (ARHGDIA) S34 Uniprot
P52565 (ARHGDIA) S96 Uniprot
P52566 (ARHGDIB) S31 Uniprot
P53004 (BLVRA) S149 Uniprot
P53004 (BLVRA) S230 Uniprot
P55042 (RRAD) S214 Uniprot
P55042 (RRAD) S257 Uniprot
P55042 (RRAD) S273 Uniprot
P55042 (RRAD) S290 Uniprot
P55042 (RRAD) S299 Uniprot
P55087 (AQP4) S180 Uniprot
P55273 (CDKN2D) S76 Uniprot
P55273 (CDKN2D) T141 Uniprot
P56537 (EIF6) S235 Uniprot
P60880 (SNAP25) T138 Uniprot
P60880 (SNAP25) S187 Uniprot
P60983 (GMFB) S72 Uniprot
P61764-1 (STXBP1) S306 Uniprot
P61764-2 (STXBP1) S313 Uniprot
P78536 (ADAM17) T735 Uniprot
P81274 (GPSM2) S408 Uniprot
Q01814-1 (ATP2B2) T1139 Uniprot
Q01844 (EWSR1) S266 Uniprot
Q01954 (BNC1) S541 Uniprot
Q01970 (PLCB3) S1105 Uniprot
Q01995 (TAGLN) S181 Uniprot
Q02156 (PRKCE) S234 Uniprot
Q02156 (PRKCE) S316 Uniprot
Q02156 (PRKCE) S368 Uniprot
Q03060-16 (CREM) S87 Uniprot
Q03721 (KCNC4) S15 Uniprot
Q03721 (KCNC4) S21 Uniprot
Q04637 (EIF4G1) S1185 Uniprot
Q05193 (DNM1) S778 Uniprot
Q05193-1 (DNM1) S795 Uniprot
Q05209 (PTPN12) S39 Uniprot
Q05209 (PTPN12) S435 Uniprot
Q05682 (CALD1) S643 Uniprot
Q05682 (CALD1) S656 Uniprot
Q05682 (CALD1) S677 Uniprot
Q05940 (SLC18A2) S15 Uniprot
Q05940 (SLC18A2) S18 Uniprot
Q06124-2 (PTPN11) S576 Uniprot
Q06124 (PTPN11) S580 Uniprot
Q06124 (PTPN11) S595 Uniprot
Q06210-2 (GFPT1) S205 Uniprot
Q06210-2 (GFPT1) S235 Uniprot
Q06481 (APLP2) T723 Uniprot
Q07617-1 (SPAG1) S317 Uniprot
Q07869 (PPARA) S179 Uniprot
Q07869 (PPARA) S230 Uniprot
Q07954 (LRP1) T4460 Uniprot
Q07954 (LRP1) S4517 Uniprot
Q07954 (LRP1) S4520 Uniprot
Q07954 (LRP1) S4523 Uniprot
Q09472 (EP300) S89 Uniprot
Q12791 (KCNMA1) S1200 Uniprot
Q12809 (KCNH2) S890 Uniprot
Q12879-1 (GRIN2A) S1416 Uniprot
Q12959 (DLG1) T657 Uniprot
Q13002 (GRIK2) S868 Uniprot
Q13224 (GRIN2B) S1303 Uniprot
Q13224 (GRIN2B) S1323 Uniprot
Q13255 (GRM1) T695 Uniprot
Q13303 (KCNAB2) S266 Uniprot
Q13393 (PLD1) S2 Uniprot
Q13393 (PLD1) T147 Uniprot
Q13393 (PLD1) S561 Uniprot
Q13418 (ILK) T173 Uniprot
Q13418 (ILK) T181 Uniprot
Q13507 (TRPC3) S700 Uniprot
Q13507 (TRPC3) S703 Uniprot
Q13507-3 (TRPC3) S712 Uniprot
Q13522 (PPP1R1A) S67 Uniprot
Q13522 (PPP1R1A) T75 Uniprot
Q13574-4 (DGKZ) S266 Uniprot
Q13574-3 (DGKZ) S282 Uniprot
Q13769 (THOC5) S5 Uniprot
Q13769 (THOC5) S6 Uniprot
Q13976-2 (PRKG1) T57 Uniprot
Q13976 (PRKG1) T59 Uniprot
Q14432 (PDE3A) S292 Uniprot
Q14432 (PDE3A) S293 Uniprot
Q14432 (PDE3A) S312 Uniprot
Q14432 (PDE3A) S428 Uniprot
Q14432 (PDE3A) S438 Uniprot
Q14432 (PDE3A) S465 Uniprot
Q14432 (PDE3A) S492 Uniprot
Q14469 (HES1) S37 Uniprot
Q14469 (HES1) S38 Uniprot
Q14994 (NR1I3) T38 Uniprot
Q15080 (NCF4) T154 Uniprot
Q15080 (NCF4) S315 Uniprot
Q15121 (PEA15) S104 Uniprot
Q15139 (PRKD1) S738 Uniprot
Q15139 (PRKD1) S742 Uniprot
Q15172 (PPP2R5A) S41 Uniprot
Q15311 (RALBP1) S118 Uniprot
Q15311 (RALBP1) T297 Uniprot
Q15311 (RALBP1) S353 Uniprot
Q15311 (RALBP1) S509 Uniprot
Q15717 (ELAVL1) S158 Uniprot
Q15717 (ELAVL1) S221 Uniprot
Q15717 (ELAVL1) S318 Uniprot
Q15762 (CD226) S329 Uniprot
Q16236 (NFE2L2) S40 Uniprot
Q16625-1 (OCLN) S340 Uniprot
Q16658 (FSCN1) S39 Uniprot
Q16760-2 (DGKD) S22 Uniprot
Q16760-2 (DGKD) S26 Uniprot
Q16760-1 (DGKD) S66 Uniprot
Q16760-1 (DGKD) S70 Uniprot
Q16875 (PFKFB3) S461 Uniprot
Q5JVS0 (HABP4) T354 Uniprot
Q5JVS0-1 (HABP4) T375 Uniprot
Q5NUL3-2 (FFAR4) T347 Uniprot
Q5NUL3-2 (FFAR4) S350 Uniprot
Q5NUL3-2 (FFAR4) S357 Uniprot
Q6UVK1 (CSPG4) T2252 Uniprot
Q86UR1 (NOXA1) S172 Uniprot
Q86VB7 (CD163) S1084 Uniprot
Q8N0W4 (NLGN4X) T707 Uniprot
Q8N556 (AFAP1) S277 Uniprot
Q8N726 (CDKN2A) T8 Uniprot
Q8NER1 (TRPV1) S502 Uniprot
Q8NER1 (TRPV1) S801 Uniprot
Q8NFA2-3 (NOXO1) S154 Uniprot
Q8NFA2-3 (NOXO1) T341 Uniprot
Q8NFA2 (NOXO1) T346 Uniprot
Q8TD43 (TRPM4) S1145 Uniprot
Q8TD43 (TRPM4) S1152 Uniprot
Q8WTQ7 (GRK7) S36 Uniprot
Q8WZ42 (TTN) S11878 Uniprot
Q8WZ42 (TTN) S12022 Uniprot
Q92681 (RSC1A1) S366 Uniprot
Q92686 (NRGN) S36 Uniprot
Q92837 (FRAT1) S188 Uniprot
Q969H0 (FBXW7) S10 Uniprot
Q969H0 (FBXW7) S18 Uniprot
Q96A00 (PPP1R14A) T38 Uniprot
Q96C90 (PPP1R14B) T57 Uniprot
Q96KS0 (EGLN2) S132 Uniprot
Q96KS0 (EGLN2) S226 Uniprot
Q96KS0 (EGLN2) S234 Uniprot
Q96MS0 (ROBO3) S1330 Uniprot
Q96PH1-4 (NOX5) S490 Uniprot
Q96PH1-4 (NOX5) T494 Uniprot
Q96PH1-4 (NOX5) S498 Uniprot
Q96PH1 (NOX5) S536 Uniprot
Q96PH1 (NOX5) T540 Uniprot
Q96PH1 (NOX5) S544 Uniprot
Q96PY5-3 (FMNL2) S1072 Uniprot
Q96RI1-2 (NR1H4) S135 Uniprot
Q96RI1 (NR1H4) S145 Uniprot
Q96RI1-2 (NR1H4) S154 Uniprot
Q96RI1 (NR1H4) S164 Uniprot
Q99418-2 (CYTH2) S391 Uniprot
Q99418-1 (CYTH2) S392 Uniprot
Q99801 (NKX3-1) S48 Uniprot
Q9BQE3 (TUBA1C) S158 Uniprot
Q9BQE3 (TUBA1C) S165 Uniprot
Q9BR39 (JPH2) S165 Uniprot
Q9BR76 (CORO1B) S2 Uniprot
Q9BZL6 (PRKD2) S706 Uniprot
Q9BZL6 (PRKD2) S710 Uniprot
Q9BZL6 (PRKD2) S876 Uniprot
Q9H1D0 (TRPV6) T742 Uniprot
Q9H3Q1 (CDC42EP4) S18 Uniprot
Q9H3Q1 (CDC42EP4) S80 Uniprot
Q9HAN9 (NMNAT1) S136 Uniprot
Q9NQ66-2 (PLCB1) S887 Uniprot
Q9NQA5 (TRPV5) S299 Uniprot
Q9NQA5 (TRPV5) S654 Uniprot
Q9NRD5 (PICK1) S77 Uniprot
Q9NRF2 (SH2B1) S161 Uniprot
Q9NRF2 (SH2B1) S165 Uniprot
Q9NRY4 (ARHGAP35) S1221 Uniprot
Q9NRY4 (ARHGAP35) T1226 Uniprot
Q9NRY4 (ARHGAP35) S1236 Uniprot
Q9NS23-2 (RASSF1) S197 Uniprot
Q9NS23-2 (RASSF1) S203 Uniprot
Q9UBS0 (RPS6KB2) S473 Uniprot
Q9UEY8-2 (ADD3) S661 Uniprot
Q9UEY8-1 (ADD3) S693 Uniprot
Q9UJY1 (HSPB8) S14 Uniprot
Q9UJY1 (HSPB8) T63 Uniprot
Q9UKG1 (APPL1) S430 Uniprot
Q9UQ80 (PA2G4) S360 Uniprot
Q9UQ80-1 (PA2G4) S363 Uniprot
Q9UQ80 (PA2G4) T366 Uniprot
Q9Y624-1 (F11R) T70 Uniprot
Q9Y624-1 (F11R) T92 Uniprot
Q9Y624 (F11R) S284 Uniprot
Q9Y6H6 (KCNE3) S82 Uniprot
Substrate Site Source
O94768 (STK17B) S351 Uniprot
P04004 (VTN) S381 Uniprot
P04049 (RAF1) S497 Uniprot
P04049 (RAF1) S619 Uniprot
P04083 (ANXA1) S27 Uniprot
P06127 (CD5) T434 Uniprot
P06127 (CD5) T436 Uniprot
P06730-1 (EIF4E) S209 Uniprot
P07900 (HSP90AA1) T115 Uniprot
P07900 (HSP90AA1) T425 Uniprot
P07900 (HSP90AA1) T603 Uniprot
P08138 (NGFR) S277 Uniprot
P10636-8 (MAPT) S258 Uniprot
P10636-8 (MAPT) S293 Uniprot
P10636-8 (MAPT) S324 Uniprot
P10636-8 (MAPT) S352 Uniprot
P11388-1 (TOP2A) S29 Uniprot
P17302 (GJA1) S368 Uniprot
P19429 (TNNI3) S42 Uniprot
P19429 (TNNI3) S44 Uniprot
P21730 (C5AR1) S334 Uniprot
P25098 (GRK2) S29 Uniprot
P28329-3 (CHAT) T255 Uniprot
P28329-3 (CHAT) S346 Uniprot
P28329-3 (CHAT) S347 Uniprot
P28329 (CHAT) T373 Uniprot
P28329-3 (CHAT) S440 Uniprot
P28329 (CHAT) S464 Uniprot
P28329 (CHAT) S465 Uniprot
P28329-3 (CHAT) S476 Uniprot
P28329 (CHAT) S558 Uniprot
P28329 (CHAT) S594 Uniprot
P29474 (NOS3) T495 Uniprot
P30086 (PEBP1) S153 Uniprot
P34741 (SDC2) S187 Uniprot
P34741 (SDC2) S188 Uniprot
P35568 (IRS1) S1101 Uniprot
P41180 (CASR) T888 Uniprot
P41594-2 (GRM5) S840 Uniprot
P43629 (KIR3DL1) S415 Uniprot
P48058 (GRIA4) S862 Uniprot
P49619 (DGKG) S779 Uniprot
P49619 (DGKG) S782 Uniprot
P49768 (PSEN1) S346 Uniprot
P49840 (GSK3A) S21 Uniprot
P49841 (GSK3B) S9 Uniprot
P50281 (MMP14) T567 Uniprot
P61764-2 (STXBP1) S306 Uniprot
P61764-1 (STXBP1) S313 Uniprot
P98082 (DAB2) S24 Uniprot
Q03721 (KCNC4) S8 Uniprot
Q03721 (KCNC4) S9 Uniprot
Q03721 (KCNC4) S15 Uniprot
Q03721 (KCNC4) S21 Uniprot
Q05586 (GRIN1) S890 Uniprot
Q13224 (GRIN2B) S1303 Uniprot
Q13224 (GRIN2B) S1323 Uniprot
Q14155 (ARHGEF7) S518 Uniprot
Q14155 (ARHGEF7) S761 Uniprot
Q16625-1 (OCLN) S340 Uniprot
Q5JVS0-1 (HABP4) T354 Uniprot
Q5JVS0 (HABP4) T375 Uniprot
Q7Z2E3 (APTX) T125 Uniprot
Q92686 (NRGN) S36 Uniprot
Q99418-2 (CYTH2) S391 Uniprot
Q99418-1 (CYTH2) S392 Uniprot
Q9UBS0 (RPS6KB2) S473 Uniprot
Q9UQ80-1 (PA2G4) S363 Uniprot
Q9UQ80-1 (PA2G4) T366 Uniprot
Substrate Site Source
P04083 (ANXA1) S27 Uniprot
P05107 (ITGB2) S745 Uniprot
P05107 (ITGB2) T758 Uniprot
P09211 (GSTP1) S43 Uniprot
P09211 (GSTP1) S185 Uniprot
P24723 (PRKCH) S28 Uniprot
P24723 (PRKCH) S32 Uniprot
P29474 (NOS3) T495 Uniprot
P49840 (GSK3A) S21 Uniprot
P49841 (GSK3B) S9 Uniprot
Q04206 (RELA) S536 Uniprot
Q06124-2 (PTPN11) S576 Uniprot
Q06124 (PTPN11) S580 Uniprot
Q06124 (PTPN11) S595 Uniprot
Q15139 (PRKD1) S738 Uniprot
Q15139 (PRKD1) S742 Uniprot
Q16625 (OCLN) T403 Uniprot
Q16625 (OCLN) T404 Uniprot
Q9BZL6 (PRKD2) S706 Uniprot
Q9BZL6 (PRKD2) S710 Uniprot
Q9BZL6 (PRKD2) S876 Uniprot

Research Backgrounds

Function:

Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that is involved in positive and negative regulation of cell proliferation, apoptosis, differentiation, migration and adhesion, tumorigenesis, cardiac hypertrophy, angiogenesis, platelet function and inflammation, by directly phosphorylating targets such as RAF1, BCL2, CSPG4, TNNT2/CTNT, or activating signaling cascade involving MAPK1/3 (ERK1/2) and RAP1GAP. Involved in cell proliferation and cell growth arrest by positive and negative regulation of the cell cycle. Can promote cell growth by phosphorylating and activating RAF1, which mediates the activation of the MAPK/ERK signaling cascade, and/or by up-regulating CDKN1A, which facilitates active cyclin-dependent kinase (CDK) complex formation in glioma cells. In intestinal cells stimulated by the phorbol ester PMA, can trigger a cell cycle arrest program which is associated with the accumulation of the hyper-phosphorylated growth-suppressive form of RB1 and induction of the CDK inhibitors CDKN1A and CDKN1B. Exhibits anti-apoptotic function in glioma cells and protects them from apoptosis by suppressing the p53/TP53-mediated activation of IGFBP3, and in leukemia cells mediates anti-apoptotic action by phosphorylating BCL2. During macrophage differentiation induced by macrophage colony-stimulating factor (CSF1), is translocated to the nucleus and is associated with macrophage development. After wounding, translocates from focal contacts to lamellipodia and participates in the modulation of desmosomal adhesion. Plays a role in cell motility by phosphorylating CSPG4, which induces association of CSPG4 with extensive lamellipodia at the cell periphery and polarization of the cell accompanied by increases in cell motility. During chemokine-induced CD4(+) T cell migration, phosphorylates CDC42-guanine exchange factor DOCK8 resulting in its dissociation from LRCH1 and the activation of GTPase CDC42. Is highly expressed in a number of cancer cells where it can act as a tumor promoter and is implicated in malignant phenotypes of several tumors such as gliomas and breast cancers. Negatively regulates myocardial contractility and positively regulates angiogenesis, platelet aggregation and thrombus formation in arteries. Mediates hypertrophic growth of neonatal cardiomyocytes, in part through a MAPK1/3 (ERK1/2)-dependent signaling pathway, and upon PMA treatment, is required to induce cardiomyocyte hypertrophy up to heart failure and death, by increasing protein synthesis, protein-DNA ratio and cell surface area. Regulates cardiomyocyte function by phosphorylating cardiac troponin T (TNNT2/CTNT), which induces significant reduction in actomyosin ATPase activity, myofilament calcium sensitivity and myocardial contractility. In angiogenesis, is required for full endothelial cell migration, adhesion to vitronectin (VTN), and vascular endothelial growth factor A (VEGFA)-dependent regulation of kinase activation and vascular tube formation. Involved in the stabilization of VEGFA mRNA at post-transcriptional level and mediates VEGFA-induced cell proliferation. In the regulation of calcium-induced platelet aggregation, mediates signals from the CD36/GP4 receptor for granule release, and activates the integrin heterodimer ITGA2B-ITGB3 through the RAP1GAP pathway for adhesion. During response to lipopolysaccharides (LPS), may regulate selective LPS-induced macrophage functions involved in host defense and inflammation. But in some inflammatory responses, may negatively regulate NF-kappa-B-induced genes, through IL1A-dependent induction of NF-kappa-B inhibitor alpha (NFKBIA/IKBA). Upon stimulation with 12-O-tetradecanoylphorbol-13-acetate (TPA), phosphorylates EIF4G1, which modulates EIF4G1 binding to MKNK1 and may be involved in the regulation of EIF4E phosphorylation. Phosphorylates KIT, leading to inhibition of KIT activity. Phosphorylates ATF2 which promotes cooperation between ATF2 and JUN, activating transcription.

Subcellular Location:

Cytoplasm. Cell membrane>Peripheral membrane protein. Mitochondrion membrane>Peripheral membrane protein. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Recruited in a circadian manner into a nuclear complex which also includes BMAL1 and RACK1 (By similarity). Interacts with ADAP1/CENTA1. Interacts with CSPG4. Binds to CAVIN2 in the presence of phosphatidylserine (By similarity). Interacts with PRKCABP/PICK1 (via PDZ domain). Interacts with TRIM41. Interacts with PARD3.

Family&Domains:

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.

Function:

Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase involved in various cellular processes such as regulation of the B-cell receptor (BCR) signalosome, oxidative stress-induced apoptosis, androgen receptor-dependent transcription regulation, insulin signaling and endothelial cells proliferation. Plays a key role in B-cell activation by regulating BCR-induced NF-kappa-B activation. Mediates the activation of the canonical NF-kappa-B pathway (NFKB1) by direct phosphorylation of CARD11/CARMA1 at 'Ser-559', 'Ser-644' and 'Ser-652'. Phosphorylation induces CARD11/CARMA1 association with lipid rafts and recruitment of the BCL10-MALT1 complex as well as MAP3K7/TAK1, which then activates IKK complex, resulting in nuclear translocation and activation of NFKB1. Plays a direct role in the negative feedback regulation of the BCR signaling, by down-modulating BTK function via direct phosphorylation of BTK at 'Ser-180', which results in the alteration of BTK plasma membrane localization and in turn inhibition of BTK activity. Involved in apoptosis following oxidative damage: in case of oxidative conditions, specifically phosphorylates 'Ser-36' of isoform p66Shc of SHC1, leading to mitochondrial accumulation of p66Shc, where p66Shc acts as a reactive oxygen species producer. Acts as a coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and specifically mediating phosphorylation of 'Thr-6' of histone H3 (H3T6ph), a specific tag for epigenetic transcriptional activation that prevents demethylation of histone H3 'Lys-4' (H3K4me) by LSD1/KDM1A. In insulin signaling, may function downstream of IRS1 in muscle cells and mediate insulin-dependent DNA synthesis through the RAF1-MAPK/ERK signaling cascade. Participates in the regulation of glucose transport in adipocytes by negatively modulating the insulin-stimulated translocation of the glucose transporter SLC2A4/GLUT4. Phosphorylates SLC2A1/GLUT1, promoting glucose uptake by SLC2A1/GLUT1. Under high glucose in pancreatic beta-cells, is probably involved in the inhibition of the insulin gene transcription, via regulation of MYC expression. In endothelial cells, activation of PRKCB induces increased phosphorylation of RB1, increased VEGFA-induced cell proliferation, and inhibits PI3K/AKT-dependent nitric oxide synthase (NOS3/eNOS) regulation by insulin, which causes endothelial dysfunction. Also involved in triglyceride homeostasis (By similarity). Phosphorylates ATF2 which promotes cooperation between ATF2 and JUN, activating transcription.

PTMs:

Phosphorylation on Thr-500 within the activation loop renders it competent to autophosphorylate. Subsequent autophosphorylation of Thr-642 maintains catalytic competence, and autophosphorylation on Ser-661 appears to release the kinase into the cytosol. Autophosphorylation on other sites i.e. in the N-terminal and hinge regions have no effect on enzyme activity. Phosphorylation at Tyr-662 by SYK induces binding with GRB2 and contributes to the activation of MAPK/ERK signaling cascade (By similarity).

Subcellular Location:

Cytoplasm. Nucleus. Membrane>Peripheral membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with PDK1 (By similarity). Interacts in vitro with PRKCBP1. Interacts with PHLPP1 and PHLPP2; both proteins mediate its dephosphorylation. Interacts with KDM1A/LSD1, PKN1 and ANDR.

Family&Domains:

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.

Function:

Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays diverse roles in neuronal cells and eye tissues, such as regulation of the neuronal receptors GRIA4/GLUR4 and GRIN1/NMDAR1, modulation of receptors and neuronal functions related to sensitivity to opiates, pain and alcohol, mediation of synaptic function and cell survival after ischemia, and inhibition of gap junction activity after oxidative stress. Binds and phosphorylates GRIA4/GLUR4 glutamate receptor and regulates its function by increasing plasma membrane-associated GRIA4 expression. In primary cerebellar neurons treated with the agonist 3,5-dihyidroxyphenylglycine, functions downstream of the metabotropic glutamate receptor GRM5/MGLUR5 and phosphorylates GRIN1/NMDAR1 receptor which plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. May be involved in the regulation of hippocampal long-term potentiation (LTP), but may be not necessary for the process of synaptic plasticity. May be involved in desensitization of mu-type opioid receptor-mediated G-protein activation in the spinal cord, and may be critical for the development and/or maintenance of morphine-induced reinforcing effects in the limbic forebrain. May modulate the functionality of mu-type-opioid receptors by participating in a signaling pathway which leads to the phosphorylation and degradation of opioid receptors. May also contributes to chronic morphine-induced changes in nociceptive processing. Plays a role in neuropathic pain mechanisms and contributes to the maintenance of the allodynia pain produced by peripheral inflammation. Plays an important role in initial sensitivity and tolerance to ethanol, by mediating the behavioral effects of ethanol as well as the effects of this drug on the GABA(A) receptors. During and after cerebral ischemia modulate neurotransmission and cell survival in synaptic membranes, and is involved in insulin-induced inhibition of necrosis, an important mechanism for minimizing ischemic injury. Required for the elimination of multiple climbing fibers during innervation of Purkinje cells in developing cerebellum. Is activated in lens epithelial cells upon hydrogen peroxide treatment, and phosphorylates connexin-43 (GJA1/CX43), resulting in disassembly of GJA1 gap junction plaques and inhibition of gap junction activity which could provide a protective effect against oxidative stress (By similarity). Phosphorylates p53/TP53 and promotes p53/TP53-dependent apoptosis in response to DNA damage. Involved in the phase resetting of the cerebral cortex circadian clock during temporally restricted feeding. Stabilizes the core clock component ARNTL/BMAL1 by interfering with its ubiquitination, thus suppressing its degradation, resulting in phase resetting of the cerebral cortex clock (By similarity).

PTMs:

Autophosphorylation on Thr-674 appears to regulate motor functions of junctophilins, JPH3 and JPH4.

Ubiquitinated.

Subcellular Location:

Cytoplasm. Cytoplasm>Perinuclear region. Cell membrane>Peripheral membrane protein. Cell junction>Synapse>Synaptosome. Cell projection>Dendrite.
Note: Translocates to synaptic membranes on stimulation.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in Purkinje cells of the cerebellar cortex.

Subunit Structure:

Interacts with GRIA4 (By similarity). Interacts with CDCP1. Interacts with TP53INP1 and p53/TP53. Interacts with ARNTL/BMAL1 (By similarity).

Family&Domains:

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.

Function:

Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that is involved in the regulation of cell differentiation in keratinocytes and pre-B cell receptor, mediates regulation of epithelial tight junction integrity and foam cell formation, and is required for glioblastoma proliferation and apoptosis prevention in MCF-7 cells. In keratinocytes, binds and activates the tyrosine kinase FYN, which in turn blocks epidermal growth factor receptor (EGFR) signaling and leads to keratinocyte growth arrest and differentiation. Associates with the cyclin CCNE1-CDK2-CDKN1B complex and inhibits CDK2 kinase activity, leading to RB1 dephosphorylation and thereby G1 arrest in keratinocytes. In association with RALA activates actin depolymerization, which is necessary for keratinocyte differentiation. In the pre-B cell receptor signaling, functions downstream of BLNK by up-regulating IRF4, which in turn activates L chain gene rearrangement. Regulates epithelial tight junctions (TJs) by phosphorylating occludin (OCLN) on threonine residues, which is necessary for the assembly and maintenance of TJs. In association with PLD2 and via TLR4 signaling, is involved in lipopolysaccharide (LPS)-induced RGS2 down-regulation and foam cell formation. Upon PMA stimulation, mediates glioblastoma cell proliferation by activating the mTOR pathway, the PI3K/AKT pathway and the ERK1-dependent phosphorylation of ELK1. Involved in the protection of glioblastoma cells from irradiation-induced apoptosis by preventing caspase-9 activation. In camptothecin-treated MCF-7 cells, regulates NF-kappa-B upstream signaling by activating IKBKB, and confers protection against DNA damage-induced apoptosis. Promotes oncogenic functions of ATF2 in the nucleus while blocking its apoptotic function at mitochondria. Phosphorylates ATF2 which promotes its nuclear retention and transcriptional activity and negatively regulates its mitochondrial localization.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Most abundant in lung, less in heart and skin.

Subunit Structure:

Interacts with FYN and RALA (By similarity). Interacts with DGKQ.

Family&Domains:

The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor and the C2 domain is a non-calcium binding domain.

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > ErbB signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Phosphatidylinositol signaling system.

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > mTOR signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.

· Human Diseases > Substance dependence > Amphetamine addiction.

· Human Diseases > Substance dependence > Morphine addiction.

· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.

· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Overview > Choline metabolism in cancer.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Development > Axon guidance.   (View pathway)

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

· Organismal Systems > Immune system > B cell receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

· Organismal Systems > Environmental adaptation > Circadian entrainment.

· Organismal Systems > Nervous system > Long-term potentiation.

· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling.   (View pathway)

· Organismal Systems > Nervous system > Glutamatergic synapse.

· Organismal Systems > Nervous system > Cholinergic synapse.

· Organismal Systems > Nervous system > Serotonergic synapse.

· Organismal Systems > Nervous system > GABAergic synapse.

· Organismal Systems > Nervous system > Dopaminergic synapse.

· Organismal Systems > Nervous system > Long-term depression.

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels.   (View pathway)

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

· Organismal Systems > Endocrine system > Melanogenesis.

· Organismal Systems > Endocrine system > Thyroid hormone synthesis.

· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Oxytocin signaling pathway.

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.

· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.

· Organismal Systems > Digestive system > Salivary secretion.

· Organismal Systems > Digestive system > Gastric acid secretion.

· Organismal Systems > Digestive system > Pancreatic secretion.

· Organismal Systems > Digestive system > Carbohydrate digestion and absorption.

References

1). Que ZJ et al. Proteomics analysis of tumor exosomes reveals vital pathways of Jinfukang inhibiting circulating tumor cells metastasis in lung cancer. J Ethnopharmacol 2020 Jun 28;256:112802 (PubMed: 32240782) [IF=5.195]

Application: WB    Species: human    Sample: CTC-TJH-01 cells

Fig. 6. |Jinfukang inhibits the migration of CTC cells through EGF signaling pathway. (A) CTC-TJH-01 cells were treated with Jinfukang (700 μg/mL) for 24 h. Protein level of EGF, p-mTOR, p-STAT1, STAT3, p-STAT3, PRKCA, p-PRKCA, Akt1/2/3 and p-Akt were analyzed by Western blot analysis.

2). Lan Y et al. Opsin 5 is a key regulator of ultraviolet radiation induced melanogenesis in human epidermal melanocytes. Br J Dermatol 2021 Jan 5. (PubMed: 33400324)

Application: WB    Species: Human    Sample: human epidermal melanocytes(HEMs)

Figure 4 Ultraviolet radiation (UVR) activates the Ca2+ /protein kinase C (PKC)/microphthalmia-associated transcription factor (MITF) signalling pathway through opsin 5 (OPN5) and upregulates expression of tyrosinase (TYR), tyrosinase-related protein 1 (TRP1) and TRP2. (a, b) Images of representative human epidermal melanocytes (HEMs) and PIG1 human melanocyte cells loaded with the Ca2+ indicator Fluo-3 and irradiated with UVR. Scale bar = 20 µm. HEMs and PIG1 calcium fluxes were quantified by flow cytometry. Data are shown as mean  SEM of three independent experiments. Statistical significance was determined by one-way ANOVA followed by Tukey’s test. **P < 0 01 ***P < 0 001. (c, d) Cells were transfected with (c) short interfering (si)RNA against OPN5, or (d) lentivirus overexpressing OPN5 (H-OPN5), then irradiated with or without UVR and lysed after 48 h. Lysates were analysed by Western blotting using the indicated antibodies. (e, f) Cells were irradiated with and without UVR, and mitogen-activated protein kinase (MAPK) and PKC protein and phosphorylated (p-) protein levels were determined by Western blot analysis. (g) Cells were transfected with short interfering RNA (RNAi) against OPN5 irradiated with UVR and lysed after 48 h. Lysates were analysed by Western blotting using the indicated antibodies. (h, i) After inhibiting the expression of MITF with ML329, cells were irradiated with or without UVR, and lysed 48 h later to observe PKC protein expression. Beta-actin was used as a loading control. CAMKII, calmodulin-dependent protein kinase II.

3). Zhang H et al. ErbB4 mediates amyloid β‐induced neurotoxicity through JNK/tau pathway activation: implications for Alzheimer's disease. J Comp Neurol 2021 Oct;529(15):3497-3512. (PubMed: 34212389)

Application: WB    Species: Human    Sample: SH-SY5Y cells

FIGURE 7 The effect of ErbB4 deletion on molecules downstream of ErbB4 in Aβ-treated SH-SY5Y cells. (a) qPCR was performed to detect the effect of ErbB4 siRNA on Src mRNA expression. Src mRNA expression was reduced in Aβ-treated SH-SY5Y cells after ErbB4 knockdown by siRNA. *p < .05. Differences were assessed by one-way ANOVA with Newman–Keuls post hoc test; values represent mean ± SEM. β-actin was used as control. (b) Western blotting was performed to detect the effect of ErbB4 siRNA on (pan) PKC phosphorylation and protein expression. (c-f) qPCR was performed to detect the effect of ErbB4 siRNA on Fyn (c), CDK5 (d), mTOR (e), and Abl (f) mRNA, respectively

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.