Product: Phospho-PKC epsilon (Ser729) Antibody
Catalog: DF7573
Source: Rabbit
Application: WB, IHC, IF/ICC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 84 kD; 84kD(Calculated).
Uniprot: Q02156
RRID: AB_2841066

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-PKC epsilon (Ser729) Antibody detects endogenous levels of PKC epsilon only when phosphorylated at S729.
RRID:
AB_2841066
Cite Format: Affinity Biosciences Cat# DF7573, RRID:AB_2841066.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

KPCE_HUMAN; MGC125656; MGC125657; nPKC epsilon; nPKC-epsilon; PKCE; Pkcea; PRKCE; Protein kinase C epsilon; Protein kinase C epsilon type;

Immunogens

Immunogen:

A synthesized peptide derived from human PKC epsilon around the phosphorylation site of S729.

Uniprot:
Gene(ID):
Sequence:
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

PTMs - Q02156 As Substrate

Site PTM Type Enzyme
T181 Phosphorylation
T228 Phosphorylation
S234 Phosphorylation P17252 (PRKCA) , Q02156 (PRKCE)
S261 Phosphorylation
T286 Phosphorylation
T309 Phosphorylation
T314 Phosphorylation
S316 Phosphorylation P17252 (PRKCA) , Q02156 (PRKCE)
K321 Ubiquitination
S329 Phosphorylation
S334 Phosphorylation
S336 Phosphorylation
S337 Phosphorylation
S339 Phosphorylation
S344 Phosphorylation
S346 Phosphorylation P49841 (GSK3B)
S350 Phosphorylation Q15759 (MAPK11) , Q16539 (MAPK14)
S368 Phosphorylation P17252 (PRKCA) , Q02156 (PRKCE)
S380 Phosphorylation
S381 Phosphorylation
S388 Phosphorylation
K416 Ubiquitination
S418 Phosphorylation
K421 Acetylation
K430 Acetylation
Y434 Phosphorylation
T566 Phosphorylation O15530 (PDPK1)
Y573 Phosphorylation
K679 Ubiquitination
T703 Phosphorylation Q02156 (PRKCE)
T710 Phosphorylation
S729 Phosphorylation Q02156 (PRKCE)

PTMs - Q02156 As Enzyme

Substrate Site Source
O14649 (KCNK3) T383 Uniprot
O14920 (IKBKB) S177 Uniprot
O60716 (CTNND1) S268 Uniprot
O75689 (ADAP1) S87 Uniprot
O75689-1 (ADAP1) T276 Uniprot
P04899 (GNAI2) S44 Uniprot
P04899 (GNAI2) S144 Uniprot
P04899 (GNAI2) S302 Uniprot
P05556 (ITGB1) T788 Uniprot
P05556 (ITGB1) T789 Uniprot
P05783 (KRT18) S53 Uniprot
P06239 (LCK) S166 Uniprot
P08581 (MET) S985 Uniprot
P08670 (VIM) S7 Uniprot
P10636-8 (MAPT) S258 Uniprot
P10636-8 (MAPT) S293 Uniprot
P10636-8 (MAPT) S324 Uniprot
P10636-8 (MAPT) S352 Uniprot
P11362 (FGFR1) S779 Uniprot
P15336 (ATF2) T52 Uniprot
P16220 (CREB1) S133 Uniprot
P17302 (GJA1) S365 Uniprot
P17302 (GJA1) S368 Uniprot
P17302 (GJA1) S369 Uniprot
P17302 (GJA1) S373 Uniprot
P17677 (GAP43) S41 Uniprot
P18507 (GABRG2) S366 Uniprot
P19429 (TNNI3) S44 Uniprot
P20339 (RAB5A) T7 Uniprot
P21802 (FGFR2) S782 Uniprot
P23975 (SLC6A2) S259 Uniprot
P28329-3 (CHAT) S440 Uniprot
P28329 (CHAT) S464 Uniprot
P28329 (CHAT) S465 Uniprot
P28329-3 (CHAT) S476 Uniprot
P28329 (CHAT) S558 Uniprot
P28329 (CHAT) S594 Uniprot
P29474 (NOS3) T495 Uniprot
P40763 (STAT3) S727 Uniprot
P41143 (OPRD1) S344 Uniprot
P41594-2 (GRM5) S840 Uniprot
P43629 (KIR3DL1) S415 Uniprot
P46459 (NSF) S460 Uniprot
P46459 (NSF) T461 Uniprot
P46940 (IQGAP1) S1443 Uniprot
P48751 (SLC4A3) S67 Uniprot
P59047 (NLRP5) S331 Uniprot
P62491 (RAB11A) S177 Uniprot
P78536 (ADAM17) T735 Uniprot
Q02156 (PRKCE) S234 Uniprot
Q02156 (PRKCE) S316 Uniprot
Q02156 (PRKCE) S368 Uniprot
Q02156 (PRKCE) T703 Uniprot
Q02156 (PRKCE) S729 Uniprot
Q14145 (KEAP1) S599 Uniprot
Q14145 (KEAP1) S602 Uniprot
Q15139 (PRKD1) S738 Uniprot
Q15139 (PRKD1) S742 Uniprot
Q16612 (NREP) S59 Uniprot
Q16625 (OCLN) T403 Uniprot
Q16625 (OCLN) T404 Uniprot
Q16625 (OCLN) T424 Uniprot
Q16625 (OCLN) T438 Uniprot
Q86XR7 (TICAM2) S16 Uniprot
Q8NER1-1 (TRPV1) T145 Uniprot
Q8NER1 (TRPV1) S502 Uniprot
Q8NER1-1 (TRPV1) T705 Uniprot
Q8NER1-1 (TRPV1) S775 Uniprot
Q8NER1-1 (TRPV1) S801 Uniprot
Q8NER1-1 (TRPV1) S821 Uniprot
Q92934 (BAD) S75 Uniprot
Q92934 (BAD) S99 Uniprot
Q92934 (BAD) S118 Uniprot
Q92993 (KAT5) T298 Uniprot
Q92993 (KAT5) S300 Uniprot
Q96A00 (PPP1R14A) T38 Uniprot
Q99259-1 (GAD1) T91 Uniprot
Q9BZL6 (PRKD2) S706 Uniprot
Q9BZL6 (PRKD2) S710 Uniprot
Q9BZL6 (PRKD2) S876 Uniprot
Q9H9S0 (NANOG) T78 Uniprot
Q9H9S0 (NANOG) S79 Uniprot
Q9H9S0 (NANOG) S135 Uniprot
Q9H9S0 (NANOG) T200 Uniprot
Q9H9S0 (NANOG) T280 Uniprot
Q9HAW7 (UGT1A7) S432 Uniprot
Q9UBS0 (RPS6KB2) S473 Uniprot
Q9Y5Y9 (SCN10A) S1451 Uniprot

Research Backgrounds

Function:

Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin-dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblasts. Phosphorylates MARCKS, which phosphorylates and activates PTK2/FAK, leading to the spread of cardiomyocytes. Involved in the control of the directional transport of ITGB1 in mesenchymal cells by phosphorylating vimentin (VIM), an intermediate filament (IF) protein. In epithelial cells, associates with and phosphorylates keratin-8 (KRT8), which induces targeting of desmoplakin at desmosomes and regulates cell-cell contact. Phosphorylates IQGAP1, which binds to CDC42, mediating epithelial cell-cell detachment prior to migration. In HeLa cells, contributes to hepatocyte growth factor (HGF)-induced cell migration, and in human corneal epithelial cells, plays a critical role in wound healing after activation by HGF. During cytokinesis, forms a complex with YWHAB, which is crucial for daughter cell separation, and facilitates abscission by a mechanism which may implicate the regulation of RHOA. In cardiac myocytes, regulates myofilament function and excitation coupling at the Z-lines, where it is indirectly associated with F-actin via interaction with COPB1. During endothelin-induced cardiomyocyte hypertrophy, mediates activation of PTK2/FAK, which is critical for cardiomyocyte survival and regulation of sarcomere length. Plays a role in the pathogenesis of dilated cardiomyopathy via persistent phosphorylation of troponin I (TNNI3). Involved in nerve growth factor (NFG)-induced neurite outgrowth and neuron morphological change independently of its kinase activity, by inhibition of RHOA pathway, activation of CDC42 and cytoskeletal rearrangement. May be involved in presynaptic facilitation by mediating phorbol ester-induced synaptic potentiation. Phosphorylates gamma-aminobutyric acid receptor subunit gamma-2 (GABRG2), which reduces the response of GABA receptors to ethanol and benzodiazepines and may mediate acute tolerance to the intoxicating effects of ethanol. Upon PMA treatment, phosphorylates the capsaicin- and heat-activated cation channel TRPV1, which is required for bradykinin-induced sensitization of the heat response in nociceptive neurons. Is able to form a complex with PDLIM5 and N-type calcium channel, and may enhance channel activities and potentiates fast synaptic transmission by phosphorylating the pore-forming alpha subunit CACNA1B (CaV2.2). In prostate cancer cells, interacts with and phosphorylates STAT3, which increases DNA-binding and transcriptional activity of STAT3 and seems to be essential for prostate cancer cell invasion. Downstream of TLR4, plays an important role in the lipopolysaccharide (LPS)-induced immune response by phosphorylating and activating TICAM2/TRAM, which in turn activates the transcription factor IRF3 and subsequent cytokines production. In differentiating erythroid progenitors, is regulated by EPO and controls the protection against the TNFSF10/TRAIL-mediated apoptosis, via BCL2. May be involved in the regulation of the insulin-induced phosphorylation and activation of AKT1.

PTMs:

Phosphorylation on Thr-566 by PDPK1 triggers autophosphorylation on Ser-729. Phosphorylation in the hinge domain at Ser-350 by MAPK11 or MAPK14, Ser-346 by GSK3B and Ser-368 by autophosphorylation is required for interaction with YWHAB.

Subcellular Location:

Cytoplasm. Cytoplasm>Cytoskeleton. Cell membrane. Cytoplasm>Perinuclear region. Nucleus.
Note: Translocated to plasma membrane in epithelial cells stimulated by HGF. Associated with the Golgi at the perinuclear site in pre-passage fibroblasts (By similarity). In passaging cells, translocated to the cell periphery (By similarity). Translocated to the nucleus in PMA-treated cells (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Forms a ternary complex with TRIM63 and GN2BL1. Can form a complex with PDLIM5 and N-type calcium channel. Interacts with COPB1 and YWHAB (By similarity). Interacts with DGKQ and STAT3. Interacts with HSP90AB1; promotes functional activation in a heat shock-dependent manner.

Family&Domains:

The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor and the C2 domain is a non-calcium binding domain.

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Apelin signaling pathway.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Type II diabetes mellitus.

· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels.   (View pathway)

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.