Bax Antibody | Affinity Biosciences

Cites

1/6

Figure 4.

Figure 7: |OLA inhibits autophagic flux and induces apoptosis.

Figure 4.

Fig.

Product:	Bax Antibody
Catalog:	AF0083
Description:	Rabbit polyclonal antibody to Bax
Application:	WB IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.:	21kDa; 21kD(Calculated).
Uniprot:	Q07812
RRID:	AB_2833270

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:3000, IF/ICC: 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%)

Clonality:

Polyclonal

Specificity:

Bax Antibody detects endogenous levels of total Bax.

RRID:

AB_2833270
Cite Format: Affinity Biosciences Cat# AF0083, RRID:AB_2833270.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Apoptosis regulator BAX; BAX; Bax-protein; BAX_HUMAN; BAXA; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; Bcl-2-like protein 4; BCL2 associated X protein; BCL2 associated X protein omega; BCL2 associated X protein transcript variant delta2; Bcl2-L-4; BCL2L4; membrane isoform alpha;

Immunogens

Immunogen:

Uniprot:

Q07812(BAX_HUMAN) >>Visit HPA database.

Gene(ID):

BAX(581)

Expression:

Q07812 BAX_HUMAN:

Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.

Description:

Bax Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Induces the release of cytochrome c, activation of CASP3, and thereby apoptosis. Belongs to the Bcl-2 family. Homodimer. Forms heterodimers with BCL2, E1B 19K protein, BCL2L1 isoform Bcl-X(L), MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). 8 isoforms of the human protein are produced by alternative splicing.

Sequence:

Q07812 BAX_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Horse

100

Bovine

100

Dog

100

Rabbit

100

Xenopus

Sheep

Zebrafish

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q07812 As Substrate

Q07812

Site	PTM Type	Enzyme	Source
M1	Acetylation		Uniprot
R9	Methylation		Uniprot
S15	Phosphorylation		Uniprot
K21	Ubiquitination		Uniprot
T22	Phosphorylation		Uniprot
K57	Ubiquitination		Uniprot
K58	Ubiquitination		Uniprot
S60	Phosphorylation		Uniprot
K64	Ubiquitination		Uniprot
T85	Phosphorylation		Uniprot
S87	Phosphorylation		Uniprot
T135	Phosphorylation		Uniprot
T140	Phosphorylation		Uniprot
S163	Phosphorylation	P49841 (GSK3B)	Uniprot
Y164	Phosphorylation		Uniprot
T167	Phosphorylation	P27361 (MAPK3) , P28482 (MAPK1)	Uniprot
T172	Phosphorylation		Uniprot
T174	Phosphorylation		Uniprot
S184	Phosphorylation	Q05513 (PRKCZ) , P31749 (AKT1)	Uniprot
T186	Phosphorylation		Uniprot

Research Backgrounds

Q07812_BAX_HUMAN

Function:

Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein. Cytoplasm.
Note: Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.

Cytoplasm.

Cytoplasm.

Cytoplasm.

Tissue Specificity:

Subunit Structure:

Homodimer. Forms higher oligomers under stress conditions. Forms heterooligomers with BAK. Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX. Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells. Interacts with FAIM2/LFG2. Interacts with RTL10/BOP. Interacts (via a C-terminal 33 residues) with NOL3 (via CARD domain); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria. Interacts with GIMAP3/IAN4 and GIMAP5/IAN5; this interaction is increased, when cells initiate apoptosis upon IL2 withdrawal.

(Microbial infection) Interacts with adenovirus E1B 19K protein; this interaction blocks BAX oligomerization.

(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein vMIA/UL37.

(Microbial infection) Interacts with enterovirus protein 2B; this interaction activates BAX-induced apoptosis.

Family&Domains:

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Belongs to the Bcl-2 family.

Research Fields

· Cellular Processes > Cell growth and death > p53 signaling pathway. (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species. (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Colorectal cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Endometrial cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Glioma. (View pathway)

· Human Diseases > Cancers: Specific types > Thyroid cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Basal cell carcinoma. (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma. (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia. (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer. (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway. (View pathway)

· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)

References

1). Adipose Mesenchymal Stromal Cell-Derived Exosomes Carrying MiR-122-5p Antagonize the Inhibitory Effect of Dihydrotestosterone on Hair Follicles by Targeting the TGF-β1/SMAD3 Signaling Pathway. International Journal of Molecular Sciences, 2023 (PubMed: 36982775) [IF=5.6]

2). A novel long non-coding RNA LINC00355 promotes proliferation of lung adenocarcinoma cells by down-regulating miR-195 and up-regulating the expression of CCNE1. CELLULAR SIGNALLING, 2020 (PubMed: 31689506) [IF=4.8]

3). C/EBPα-mediated transcriptional activation of miR-134-5p entails KPNA3 inhibition and modulates focal hypoxic-ischemic brain damage in neonatal rats. BRAIN RESEARCH BULLETIN, 2020 (PubMed: 32814091) [IF=3.8]

Application: WB Species: rat Sample: PC12 cells

Fig. 3. |K, The mRNA and protein expression of apoptosis-related factors (Bax and Bcl-2) in PC12 cells was determined by RT-qPCR and Western blot analysis. Results were presented as mean ± standard deviation representative of at least three independent experiments. *p < 0.05 vs. sham or control (untreated PC12 cells) and # p < 0.05 vs. miR-134 antagomir + si-NC by one-way ANOVA with Tukey’s test and by Bonferronicorrected repeated measures ANOVA (panel E).

4). Dexmedetomidine alleviates cardiomyocyte apoptosis and cardiac dysfunction may be associated with inhibition of RhoA/ROCK pathway in mice with myocardial infarction. Naunyn-Schmiedeberg's archives of pharmacology, 2021 (PubMed: 33782744) [IF=3.6]

Application: WB Species: Mice Sample:

Fig. 4 DEX reduced the Bax recruitment and increased Bcl-2/Bax ratio. a, b Western blot band pictures and semi-quantitative analysis results of Bax and Bcl-2, GAPDH was used as an internal reference. c Semi quantitative analysis results of the ratio of Bax and Bcl-2. Data were presented as mean ± SEM. n = 3, *P < 0.05 and ##P < 0.01 versus sham group, *P < 0.05 and **P < 0.01 versus MI group

5). Inhibitors of PARP-1 exert inhibitory effects on the biological characteristics of hepatocellular carcinoma cells in vitro. Molecular Medicine Reports, 2017 (PubMed: 28498459) [IF=3.4]

Application: WB Species: human Sample: HepG2

Figure 4. Effects of different concentrations of AG014699 and BSI‑201 on protein levels of Caspase 3, Caspase 8, Bax and Bcl‑2 in HepG2 cells.(A) Blots showing proteins in cells treated with AGO14699 and (B) quantification. (C) Blots showing proteins in cells treated with (C) BSI‑201 and (D) quantification. * P<0.05, compared with the control group; ∆P<0.05, compared with the low dose group; ∆∆P<0.05, compared with the middle dose group. CTRL, control; Bcl‑2, B‑cell lymphoma 2; BAX, Bcl‑2‑associated X protein.

6). Angelicin inhibits liver cancer growth in vitro and in vivo. Molecular Medicine Reports, 2017 (PubMed: 28849216) [IF=3.4]

Application: WB Species: human Sample:

7). Low-Frequency Vibration Promotes Tumor Necrosis Factor-α Production to Increase Cartilage Degeneration in Knee Osteoarthritis. Cartilage, 2021 (PubMed: 32532183) [IF=2.8]

Application: WB Species: human Sample: SW1353 cells

Figure 4. |TNF-α upregulates inflammation or apoptosis through FAH. (B and C) SW1353 were co-transfected with TNF-α and FAH or FAH-siRNA; 48 hours after transfection, cells were harvested for immunoblot analysis with indicated antibodies. FAH = fumarylacetoacetase hydrolase; TNF-α = tumor necrosis factor-α.

8). Trifluoperazine Synergistically Potentiates Bortezomib-Induced Anti-Cancer Effect in Multiple Myeloma via Inhibiting P38 MAPK/NUPR1. TOHOKU JOURNAL OF EXPERIMENTAL MEDICINE, 2022 (PubMed: 35644544) [IF=2.2]

9). Olaquindox disrupts tight junction integrity and cytoskeleton architecture in mouse Sertoli cells. Oncotarget, 2017 (PubMed: 29179463)

Application: WB Species: mouse Sample: Sertoli cells

Figure 7: |OLA inhibits autophagic flux and induces apoptosis. Sertoli cells cultured on dishes were treated on day 3 with 100-, 200-, 400- or 800 μg/ml OLA for 24 h. Cells treated with vehicle (0.2% DMSO) were used as negative control. (C) Immunoblot analysis to assess the expression of cleaved-PARP, cleaved-caspase3 and Bax. Semiquantitative analyses of protein expression in following histogram (mean ± S.E.M., three independent replicates per groups). * p < 0.05; ** p < 0.01.

10). OC-STAMP Overexpression Drives Lung Alveolar Epithelial Cell Type II Senescence in Silicosis. Oxidative Medicine and Cellular Longevity, 2021 (PubMed: 34426759)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Bax Antibody - #AF0083