CKS2 Antibody - #AF0616
Product: | CKS2 Antibody |
Catalog: | AF0616 |
Description: | Rabbit polyclonal antibody to CKS2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 9kDa; 10kD(Calculated). |
Uniprot: | P33552 |
RRID: | AB_2834233 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0616, RRID:AB_2834233.
Fold/Unfold
CDC28; CDC28 protein kinase 2; CDC28 protein kinase regulatory subunit 2; CKS 2; CKS-2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog 2; Cks2; CKS2_HUMAN; CKSHS2; Cyclin dependent kinases regulatory subunit 2; Cyclin-dependent kinases regulatory subunit 2;
Immunogens
- P33552 CKS2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P33552 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K4 | Acetylation | Uniprot | |
K4 | Ubiquitination | Uniprot | |
Y7 | Phosphorylation | Uniprot | |
Y8 | Phosphorylation | Uniprot | |
K11 | Ubiquitination | Uniprot | |
Y12 | Phosphorylation | Uniprot | |
Y17 | Phosphorylation | Uniprot | |
K30 | Ubiquitination | Uniprot | |
K34 | Ubiquitination | Uniprot | |
S39 | Phosphorylation | Uniprot | |
S51 | Phosphorylation | Uniprot |
Research Backgrounds
Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
Forms a homohexamer that can probably bind six kinase subunits.
Belongs to the CKS family.
Research Fields
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Small cell lung cancer. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.