GAS41 Antibody - #AF0445
| Product: | GAS41 Antibody |
| Catalog: | AF0445 |
| Description: | Rabbit polyclonal antibody to GAS41 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Dog, Xenopus |
| Mol.Wt.: | 40kDa; 26kD(Calculated). |
| Uniprot: | O95619 |
| RRID: | AB_2834203 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0445, RRID:AB_2834203.
Fold/Unfold
4930573H17Rik; B230215M10Rik; GAS 41; Gas41; glioma amplified sequence 41; Glioma-amplified sequence 41; glioma-amplified sequence-41; gliomaamplified sequence 41; gliomaamplified sequence41; NUBI 1; NuBI-1; NuBI1; NuMA binding protein 1; NuMA-binding protein 1; YAF9; YEATS domain containing 4; YEATS domain containing4; YEATS domain-containing protein 4; YEATS4; YETS4_HUMAN;
Immunogens
Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
- O95619 YETS4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95619 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S12 | Phosphorylation | Uniprot | |
| K17 | Ubiquitination | Uniprot | |
| K23 | Ubiquitination | Uniprot | |
| S123 | Phosphorylation | Uniprot | |
| K131 | Acetylation | Uniprot | |
| K131 | Ubiquitination | Uniprot | |
| K167 | Ubiquitination | Uniprot | |
| K178 | Ubiquitination | Uniprot | |
| K189 | Ubiquitination | Uniprot | |
| K198 | Ubiquitination | Uniprot | |
| K212 | Ubiquitination | Uniprot | |
| K217 | Ubiquitination | Uniprot | |
| K225 | Ubiquitination | Uniprot |
Research Backgrounds
Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Nucleus.
Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
Component of numerous complexes with chromatin remodeling and histone acetyltransferase activity. Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. The NuA4 complex interacts with MYC and the adenovirus E1A protein. Component of a NuA4-related complex which contains EP400, TRRAP/PAF400, SRCAP, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, actin, ACTL6A/BAF53A, VPS72 and YEATS4/GAS41. YEATS4 interacts with MLLT10/AF10. YEATS4 may also interact with the SWI/SNF component SMARCB1/BAF47, TACC1 and TACC2, and the nuclear matrix protein NUMA1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.