TFIP8 Antibody - #AF0412
| Product: | TFIP8 Antibody |
| Catalog: | AF0412 |
| Description: | Rabbit polyclonal antibody to TFIP8 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 23kDa; 23kD(Calculated). |
| Uniprot: | O95379 |
| RRID: | AB_2834198 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0412, RRID:AB_2834198.
Fold/Unfold
GG2 1; Head and neck tumor and metastasis-related protein; MDC-3.13; NDED; NF-kappa-B-inducible DED-containing protein; SCC S2; SCC-S2; SCCS2; TFIP8_HUMAN; TNF alpha-induced protein 8; TNF induced protein; TNF-induced protein GG2-1; TNFAIP 8; TNFAIP8; Tumor necrosis factor alpha induced protein 8; Tumor necrosis factor alpha-induced protein 8;
Immunogens
Expressed at high levels in the spleen, lymph node, thymus, thyroid, bone marrow and placenta. Expressed at high levels both in various tumor tissues, unstimulated and cytokine-activated cultured cells. Expressed at low levels in the spinal cord, ovary, lung, adrenal glands, heart, brain, testis and skeletal muscle.
- O95379 TFIP8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95379 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S3 | Phosphorylation | Uniprot | |
| K27 | Acetylation | Uniprot | |
| K28 | Acetylation | Uniprot | |
| K36 | Acetylation | Uniprot | |
| K36 | Ubiquitination | Uniprot | |
| T78 | Phosphorylation | Uniprot | |
| K101 | Ubiquitination | Uniprot |
Research Backgrounds
Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.
Cytoplasm.
Expressed at high levels in the spleen, lymph node, thymus, thyroid, bone marrow and placenta. Expressed at high levels both in various tumor tissues, unstimulated and cytokine-activated cultured cells. Expressed at low levels in the spinal cord, ovary, lung, adrenal glands, heart, brain, testis and skeletal muscle.
Belongs to the TNFAIP8 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.