MMP9 Antibody - #AF0220

(6)   (5)  
Product: MMP9 Antibody
Catalog: AF0220
Description: Rabbit polyclonal antibody to MMP9
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 78kDa; 78kD(Calculated).
Uniprot: P14780
RRID: AB_2833350

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
MMP9 Antibody detects endogenous levels of total MMP9.
RRID:
AB_2833350
Cite Format: Affinity Biosciences Cat# AF0220, RRID:AB_2833350.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase Type 4 beta; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GelatinaseB; GELB; Macrophage gelatinase; MANDP2; Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); Matrix Metalloproteinase 9; MMP 9; MMP-9; MMP9; MMP9_HUMAN; Type V collagenase;

Immunogens

Immunogen:
Uniprot:

P14780(MMP9_HUMAN) >>Visit HPA database.

Gene(ID):
MMP9(4318)
Expression:
P14780 MMP9_HUMAN:

Detected in neutrophils (at protein level) (PubMed:7683678). Produced by normal alveolar macrophages and granulocytes.

Description:
MMP9 May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. Belongs to the peptidase M10A family. Activated by 4-aminophenylmercuric acetate and phorbol ester. Exists as monomer or homodimer; disulfide-linked. Exists also as heterodimer with a 25 kDa protein. Macrophages and transformed cell lines produce only the monomeric form. Interacts with ECM1.
Sequence:
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

PTMs - P14780 As Substrate

Site PTM Type Enzyme
T37 Phosphorylation
C99 S-Nitrosylation
Y241 Phosphorylation
S628 Phosphorylation

Research Backgrounds

Function:

May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.

PTMs:

Processing of the precursor yields different active forms of 64, 67 and 82 kDa. Sequentially processing by MMP3 yields the 82 kDa matrix metalloproteinase-9.

N- and O-glycosylated.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in neutrophils (at protein level). Produced by normal alveolar macrophages and granulocytes.

Subunit Structure:

Exists as monomer or homodimer; disulfide-linked. Exists also as heterodimer with LCN2. Macrophages and transformed cell lines produce only the monomeric form. Interacts with ECM1.

(Microbial infection) Interacts with Staphylococcus aureus protein SSL5; this interaction inhibits MMP9 activity.

Family&Domains:

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Belongs to the peptidase M10A family.

Research Fields

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). The NQO1/PKLR axis promotes lymph node metastasis and breast cancer progression by modulating glycolytic reprogramming. CANCER LETTERS, 2019 (PubMed: 30954648) [IF=9.7]
2). A novel benzothiazole derivative induces apoptosis via the mitochondrial intrinsic pathway producing antitumor activity in colorectal cancer. Frontiers in Pharmacology, 2023 (PubMed: 37288115) [IF=5.6]

Application: WB    Species: Mouse    Sample:

FIGURE 5 BTD inhibited the migration and invasion ability of cells. (A,B) Cells were treated with BTD (0, 2.5, 5, or 10 μM) for 24 h and subjected to migration (A) and invasion (B) assays, and then photographed (×100). (C) Cells were seeded, and a “wound” was created, then incubated with BTD (0, 2.5, 5, or 10 μM) for 24 h and photographed (×100). The lines indicate the area occupied by the initial scraping, and migrated cells were quantified. (D) The levels of MMP2, MMP9, and TIMP2 were detected using Western blotting. (E,F) Flow cytometry was used to analyze the cell cycle distribution. The values are shown as histograms.
3). A novel long non-coding RNA LINC00355 promotes proliferation of lung adenocarcinoma cells by down-regulating miR-195 and up-regulating the expression of CCNE1. CELLULAR SIGNALLING, 2020 (PubMed: 31689506) [IF=4.8]
4). Tropomodulin 3 promotes liver cancer progression by activating the MAPK/ERK signaling pathway. Oncology Reports, 2019 (PubMed: 30864730) [IF=4.2]

Application: WB    Species: human    Sample: HepG2TMOD3, Hep3BshTMOD3 and their control cells.

Figure 4. |TMOD3 is associated with EMT and activates the MAPK/ERK signaling pathway.N=140 (D) The expression of critical members and downstream effectors of the MAPK/ERK signaling pathway was examined by western blot analysis in HepG2TMOD3, Hep3BshTMOD3 and their control cells. TMOD3, tropomodulin 3; EMT, epithelial‑to‑mesenchymal transition; ES, enrichment score; NES, normalized enrichment score; MAPK, mitogen‑activated protein kinase; MMP, matrix metalloproteinase; ERK, extracellular signal‑regulated kinase; shRNA, short hairpin RNA; KRAS, Kirsten rat sarcoma viral proto‑oncogene; HCC, hepatocellular carcinoma.
5). Compared with High-intensity Interval Exercise, Moderate Intensity Constant Load Exercise is more effective in curbing the Growth and Metastasis of Lung Cancer. Journal of Cancer, 2022 (PubMed: 35371324) [IF=3.9]

Application: WB    Species: mouse    Sample: lung cancer

Figure 5.| The effect of exercise on EMT and its inducing factors in lung cancer tissues. D, E. The expression level of vimentin in lung cancer tissues (n=6). D, F, G. The expression levels of MMP2 (D, F) and MMP9 (D, G) in lung cancer tissues (n=6). D, H. The expression level of TGF-β1 in lung cancer tissues (n=6). D, I. The expression level of collagen type I in lung cancer tissues(n=6). Note: &, &&&& respectively represent a significant difference compared with the Saline group (P<0.05), (P<0.0001).
6). Ezrin contributes to cervical cancer progression through induction of epithelial-mesenchymal transition. Oncotarget, 2016 (PubMed: 26933912)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.