NKX3.1 Antibody - #AF0221
Product: | NKX3.1 Antibody |
Catalog: | AF0221 |
Description: | Rabbit polyclonal antibody to NKX3.1 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Horse, Rabbit, Dog |
Mol.Wt.: | 38kDa; 26kD(Calculated). |
Uniprot: | Q99801 |
RRID: | AB_2834156 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0221, RRID:AB_2834156.
Fold/Unfold
BAPX 2; BAPX2; Homeobox protein NK-3 homolog A; Homeobox protein Nkx 3.1; Homeobox protein Nkx-3.1; Homeobox protein Nkx3.1; NK homeobox (Drosophila) family 3 A; NK homeobox family 3 A; NK homeobox, family 3, member A; NK3 homeobox 1; NK3 transcription factor homolog A; NK3 transcription factor related locus 1; NKX 3; Nkx 3.1; NKX 3A; NKX3 1; NKX3; Nkx3-1; NKX3.1; Nkx3.1, mouse, homolog of; NKX31_HUMAN; NKX3A;
Immunogens
- Q99801 NKX31_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99801 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T21 | Phosphorylation | Uniprot | |
S48 | Phosphorylation | P17252 (PRKCA) | Uniprot |
T89 | Phosphorylation | P11309 (PIM1) , P19784 (CSNK2A2) | Uniprot |
T93 | Phosphorylation | P19784 (CSNK2A2) | Uniprot |
T134 | Phosphorylation | Q13315 (ATM) | Uniprot |
K159 | Ubiquitination | Uniprot | |
K162 | Ubiquitination | Uniprot | |
T166 | Phosphorylation | Q13315 (ATM) | Uniprot |
K182 | Ubiquitination | Uniprot | |
S185 | Phosphorylation | P11309 (PIM1) , Q9Y463 (DYRK1B) | Uniprot |
S186 | Phosphorylation | P11309 (PIM1) | Uniprot |
S195 | Phosphorylation | P11309 (PIM1) | Uniprot |
S196 | Phosphorylation | P11309 (PIM1) | Uniprot |
Y222 | Phosphorylation | Uniprot |
Research Backgrounds
Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Acts as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells.
Ubiquitinated by TOPORS; monoubiquitinated at several residues and also polyubiquitinated on single residues.
Nucleus.
Highly expressed in the prostate and, at a lower level, in the testis.
Interacts with serum response factor (SRF) (By similarity). Interacts with SPDEF. Interacts with WDR77. Interacts with TOPORS which polyubiquitinates NKX3-1 and induces its proteasomal degradation.
Belongs to the NK-3 homeobox family.
Research Fields
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Prostate cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.