AP2 alpha/beta Antibody | Affinity Biosciences

IHC
Cites

1/5

AF0535 at 1/100 staining human skin cancer tissue sections by IHC-P.

Fig.

Figure 7.

Figure 6 The effect of tumor-derived exosomes on miR-3960-overexpressed pancreatic cancer (PC) on the xenograft tumor model.

Figure 10 External experimental verification.

Product:	AP2 alpha/beta Antibody
Catalog:	AF0535
Description:	Rabbit polyclonal antibody to AP2 alpha/beta
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.:	49kDa; 48kD,50kD(Calculated).
Uniprot:	P05549 \| Q92481
RRID:	AB_2834124

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(100%), Zebrafish(83%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(83%)

Clonality:

Polyclonal

Specificity:

AP2 alpha/beta Antibody detects endogenous levels of total AP2 alpha/beta.

RRID:

AB_2834124
Cite Format: Affinity Biosciences Cat# AF0535, RRID:AB_2834124.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Activating enhancer binding protein 2 alpha; Activating enhancer-binding protein 2-alpha; Activator protein 2; AP 2 transcription factor; AP 2alpha; AP-2; AP-2 transcription factor; AP2; AP2 Transcription Factor; AP2-alpha; AP2A_HUMAN; AP2TF; BOFS; FLJ51761; TFAP 2; TFAP 2A; TFAP2; TFAP2A; Transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha); Transcription factor AP-2-alpha; Transcription factor AP2 alpha; Activating enhancer binding protein 2 beta; Activating enhancer-binding protein 2-beta; AP 2B; AP2 B; AP2-beta; AP2B; AP2B_HUMAN; AP2beta; MGC21381; OTTHUMP00000039925; PDA2; TFAP 2B; Tfap2b; Transcription factor AP 2 beta; Transcription factor AP-2-beta; Transcription factor AP2 beta;

Immunogens

Immunogen:

Uniprot:

P05549(AP2A_HUMAN) >>Visit HPA database.

Q92481(AP2B_HUMAN) >>Visit HPA database.

Gene(ID):

TFAP2A(7020) | TFAP2B(7021)

Description:

AP-2 alpha Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.

Sequence:

P05549 AP2A_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

Q92481 AP2B_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Horse

100

Bovine

100

Sheep

100

Dog

100

Chicken

100

Rabbit

100

Xenopus

Zebrafish

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P05549/Q92481 As Substrate

P05549
Q92481

Site	PTM Type	Enzyme	Source
K10	Sumoylation		Uniprot
K10	Ubiquitination		Uniprot
Y73	Phosphorylation		Uniprot
S119	Phosphorylation		Uniprot
K177	Sumoylation		Uniprot
K177	Ubiquitination		Uniprot
S181	Phosphorylation		Uniprot
K184	Ubiquitination		Uniprot
S185	Phosphorylation		Uniprot
S187	Phosphorylation		Uniprot
K197	Ubiquitination		Uniprot
S219	Phosphorylation	P54646 (PRKAA2)	Uniprot
S223	Phosphorylation		Uniprot
S225	Phosphorylation		Uniprot
K226	Ubiquitination		Uniprot
K228	Ubiquitination		Uniprot
S239	Phosphorylation	P17612 (PRKACA)	Uniprot
S258	Phosphorylation	Q15139 (PRKD1)	Uniprot
K268	Ubiquitination		Uniprot
K271	Ubiquitination		Uniprot
K282	Ubiquitination		Uniprot
K315	Ubiquitination		Uniprot
S326	Phosphorylation	Q15139 (PRKD1)	Uniprot
K335	Ubiquitination		Uniprot
K411	Ubiquitination		Uniprot
S428	Phosphorylation		Uniprot
S429	Phosphorylation	P68400 (CSNK2A1)	Uniprot

Site	PTM Type	Source
S3	Phosphorylation	Uniprot
K15	Ubiquitination	Uniprot
K21	Sumoylation	Uniprot
S120	Phosphorylation	Uniprot
S242	Phosphorylation	Uniprot
S244	Phosphorylation	Uniprot
K245	Ubiquitination	Uniprot
S258	Phosphorylation	Uniprot
K301	Ubiquitination	Uniprot
K354	Ubiquitination	Uniprot

Research Backgrounds

P05549_AP2A_HUMAN
Q92481_AP2B_HUMAN

Function:

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.

PTMs:

Sumoylated on Lys-10; which inhibits transcriptional activity.

Subcellular Location:

Nucleus.

Subunit Structure:

Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with WWOX. Interacts with CITED4. Interacts with UBE2I. Interacts with RALBP1 in a complex also containing EPN1 and NUMB during interphase and mitosis. Interacts with KCTD1; this interaction represses transcription activation. Interacts (via C-terminus) with CITED2 (via C-terminus); the interaction stimulates TFAP2A-transcriptional activation. Interacts (via N-terminus) with EP300 (via N-terminus); the interaction requires CITED2. Interacts with KCTD15; this interaction inhibits TFAP2A transcriptional activation.

Family&Domains:

The PPxY motif mediates interaction with WWOX.

Belongs to the AP-2 family.

Function:

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-beta appears to be required for normal face and limb development and for proper terminal differentiation and function of renal tubular epithelia.

PTMs:

Sumoylated on Lys-21; which inhibits transcriptional activity.

Subcellular Location:

Nucleus.

Subunit Structure:

Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with CITED4. Interacts with UBE2I. Interacts with KCTD1; this interaction represses transcription activation. Interacts with CITED2 (via C-terminus); the interaction stimulates TFAP2B-transcriptional activity.

Family&Domains:

Belongs to the AP-2 family.

References

1). E4BP4 mediates glucocorticoid-regulated adipogenesis through COX2. MOLECULAR AND CELLULAR ENDOCRINOLOGY, 2017 (PubMed: 28416324) [IF=4.1]

Application: WB Species: mouse Sample:

Fig. 3. E4BP4 mediates the actions of glucocorticoid in adipocyte formation. (a, b) The adipogenic phenotypes of 3T3-L1 cells transfected with pCDNA3.1-E4BP4 or control after induction by MI for 6 days were assessed by ORO staining. (b) Triglyceride accumulation was quantified and normalized to protein amount. (c) The mRNA levels of PPARg2, aP2, adiponectin, and LPL at day 6 were detected by qPCR. (d) The protein levels of PPARg and aP2 at day 6 were measured by Western blot. (e) The adipogenic phenotypes of 3T3-L1 cells transfected with siE4BP4 or control after being induced by DEX only for 6 days were assessed by ORO staining. (f) Triglyceride accumulation was quantified and normalized to protein amount. (g) qPCR analysis of PPARg2, aP2, adiponectin, and LPL. (h) Western blot analysis of PPARg and aP2. The results are expressed as mean ± SD (n ¼ 3); *P < 0.05 and **P < 0.01 indicate significant difference from the control.

2). Identification of lysosomal genes associated with prognosis in lung adenocarcinoma. Translational Lung Cancer Research, 2023 (PubMed: 37577321) [IF=4.0]

Application: WB Species: Human Sample: LUAD and adjacent tissues

Figure 10 External experimental verification. (A) Relative mRNA expression of GATA2, TFAP2A, LMBRD1, and KRT8 in LUAD and lung bronchial epithelial cell lines. (B) Protein expression levels of GATA2, TFAP2A, LMBRD1, and KRT8 in LUAD and adjacent tissues. *, P

3). Autologous decellularized extracellular matrix promotes adipogenic differentiation of adipose derived stem cells in low serum culture system by regulating the ERK1/2-PPARγ pathway. Adipocyte, 2021 (PubMed: 33825675) [IF=3.3]

Application: WB Species: Human Sample: ADSCs

Figure 7. Effects of d-ECM on the ERK1/2-PPARγ pathway and the expression of adipocyte secreting factors ADIPOQ and aP2 in the fully differentiated ADSCs. After 3-days treatments and 14-days adipogenic induction, ADSCs at the 5th passage were collected and used for Western blotting analysis (a). Protein levels of ERK1/2 (b), p-ERK1/2 (c), PPARγ (d), p-PPARγ (e), ADIPOQ (f) and aP2 (g) were examined. GAPDH demonstrated the equal loading of protein samples. N = 3. *, p < 0.05, vs. 10% FBS group; **, p < 0.01, vs. 10% FBS group; #, p < 0.05, vs. 2% FBS group; ##, p < 0.01, vs. 2% FBS group; $, p < 0.05, vs. 2% FBS + d-ECM group; $$, p < 0.01, vs. 2% FBS + d-ECM group. ADIPOQ, adiponectin; aP2, adipocyte fatty-acid binding protein

4). Pancreatic Cancer-Derived Exosomes Promote the Proliferation, Invasion, and Metastasis of Pancreatic Cancer by the miR-3960/TFAP2A Axis. Journal of Oncology, 2022 (PubMed: 36284637)

Application: WB Species: Mice Sample: lung

Figure 6 The effect of tumor-derived exosomes on miR-3960-overexpressed pancreatic cancer (PC) on the xenograft tumor model. (x¯±s, n =7) (a) The photographs of tumors dissected from PC mice. (b) The tumor volume. (c) The tumor weight. (d-f) The semi-quantitative score and typical picture of Hematoxylin-eosin staining in the lungs and livers. (×400) (g-i) The Bax and Bcl-2 protein levels in the lungs of PC mice. (j-m) The p-AKT/AKT, PTEN, TFAP2A levels in the lungs of PC mice (n =3). ##P <0.01 compared to the Exo + miR-NC group.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

AP2 alpha/beta Antibody - #AF0535