Phospho-MAPKAPK5 (Thr182) Antibody - #AF0061
Product: | Phospho-MAPKAPK5 (Thr182) Antibody |
Catalog: | AF0061 |
Description: | Rabbit polyclonal antibody to Phospho-MAPKAPK5 (Thr182) |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 60kDa; 54kD(Calculated). |
Uniprot: | Q8IW41 |
RRID: | AB_2834104 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0061, RRID:AB_2834104.
Fold/Unfold
MAP kinase-activated protein kinase 5; MAPK-activated protein kinase 5; MAPK5_HUMAN; MAPKAP kinase 5; MAPKAPK-5; MAPKAPK5; Mitogen activated protein kinase activated protein kinase 5; p38-regulated/activated protein kinase; PRAK;
Immunogens
- Q8IW41 MAPK5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
PTMs - Q8IW41 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S93 | Phosphorylation | Uniprot | |
S115 | Phosphorylation | P17612 (PRKACA) | Uniprot |
K123 | Ubiquitination | Uniprot | |
K166 | Ubiquitination | Uniprot | |
T182 | Phosphorylation | P53778 (MAPK12) , P28482 (MAPK1) , O15264 (MAPK13) , P31152 (MAPK4) , P45984 (MAPK9) , Q15759 (MAPK11) , Q16539 (MAPK14) , Q16659 (MAPK6) | Uniprot |
T186 | Phosphorylation | Uniprot | |
Y188 | Phosphorylation | Uniprot | |
K205 | Ubiquitination | Uniprot | |
S206 | Phosphorylation | Uniprot | |
S212 | Phosphorylation | Uniprot | |
T214 | Phosphorylation | Uniprot | |
Y242 | Phosphorylation | Uniprot | |
K286 | Ubiquitination | Uniprot | |
S348 | Phosphorylation | Uniprot | |
S354 | Phosphorylation | Uniprot | |
T368 | Phosphorylation | Uniprot | |
S469 | Phosphorylation | Uniprot | |
S472 | Phosphorylation | Uniprot |
PTMs - Q8IW41 As Enzyme
Substrate | Site | Source |
---|---|---|
O00418 (EEF2K) | S377 | Uniprot |
O43524 (FOXO3) | S215 | Uniprot |
O60229 (KALRN) | S487 | Uniprot |
P04637 (TP53) | S37 | Uniprot |
P04792 (HSPB1) | S15 | Uniprot |
P04792 (HSPB1) | S78 | Uniprot |
P04792 (HSPB1) | S82 | Uniprot |
P07101-3 (TH) | S19 | Uniprot |
P07101-3 (TH) | S40 | Uniprot |
P07101-3 (TH) | S404 | Uniprot |
P25685 (DNAJB1) | S149 | Uniprot |
P25685 (DNAJB1) | S151 | Uniprot |
P25685 (DNAJB1) | S171 | Uniprot |
P31152 (MAPK4) | S186 | Uniprot |
P47712 (PLA2G4A) | S727 | Uniprot |
Q15382 (RHEB) | S130 | Uniprot |
Q92599 (SEPT8) | S163 | Uniprot |
Q92599 (SEPT8) | S192 | Uniprot |
Research Backgrounds
Tumor suppressor serine/threonine-protein kinase involved in mTORC1 signaling and post-transcriptional regulation. Phosphorylates FOXO3, ERK3/MAPK6, ERK4/MAPK4, HSP27/HSPB1, p53/TP53 and RHEB. Acts as a tumor suppressor by mediating Ras-induced senescence and phosphorylating p53/TP53. Involved in post-transcriptional regulation of MYC by mediating phosphorylation of FOXO3: phosphorylation of FOXO3 leads to promote nuclear localization of FOXO3, enabling expression of miR-34b and miR-34c, 2 post-transcriptional regulators of MYC that bind to the 3'UTR of MYC transcript and prevent MYC translation. Acts as a negative regulator of mTORC1 signaling by mediating phosphorylation and inhibition of RHEB. Part of the atypical MAPK signaling via its interaction with ERK3/MAPK6 or ERK4/MAPK4: the precise role of the complex formed with ERK3/MAPK6 or ERK4/MAPK4 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPK (ERK3/MAPK6 or ERK4/MAPK4), ERK3/MAPK6 (or ERK4/MAPK4) is phosphorylated and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6 (or ERK4/MAPK4). Mediates phosphorylation of HSP27/HSPB1 in response to PKA/PRKACA stimulation, inducing F-actin rearrangement.
Phosphorylated on Thr-182 ERK3/MAPK6 or ERK4/MAPK4; which is the regulatory phosphorylation site and is located on the T-loop/loop 12, leading to activation. Phosphorylation at Thr-182 by p38-alpha/MAPK14, p38-beta/MAPK11 is subject to debate. Phosphorylated at Ser-115 by PKA/PRKACA, leading to localization to the cytoplasm. Autophosphorylated (By similarity).
Cytoplasm. Nucleus.
Note: Translocates to the cytoplasm following phosphorylation and activation. Interaction with ERK3/MAPK6 or ERK4/MAPK4 and phosphorylation at Thr-182, activates the protein kinase activity, followed by translocation to the cytoplasm. Phosphorylation by PKA/PRKACA at Ser-115 also induces nuclear export.
Expressed ubiquitously.
Interacts with ERK3/MAPK6 and ERK4/MAPK4 (via FRIEDE motif); the interaction is direct (By similarity). Interacts with YWHAE; the interaction prevents phosphorylation of HSP27/HSPB1 leading to disrupt F-actin polymerization. Interacts with SQSTM1.
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
Research Fields
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.